PPIF anticorps
-
- Antigène Voir toutes PPIF Anticorps
- PPIF (Peptidylprolyl Isomerase F (PPIF))
-
Reactivité
- Humain, Rat, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PPIF est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Purified
- Immunogène
- PPIF antibody was raised using a synthetic peptide corresponding to a region with amino acids GSTFHRVIPSFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVLS
- Top Product
- Discover our top product PPIF Anticorps primaire
-
-
- Indications d'application
-
WB: 5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PPIF Blocking Peptide, catalog no. 33R-3589, is also available for use as a blocking control in assays to test for specificity of this PPIF antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPIF antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PPIF (Peptidylprolyl Isomerase F (PPIF))
- Autre désignation
- PPIF (PPIF Produits)
- Sujet
- PPIF is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein is part of the mitochondrial permeability transition pore in the inner mitochondrial membrane. Activation of this pore is thought to be involved in the induction of apoptotic and necrotic cell death.
- Poids moléculaire
- 19 kDa (MW of target protein)
- Pathways
- Proton Transport, Negative Regulation of intrinsic apoptotic Signaling, Negative Regulation of Transporter Activity
-