PPIF anticorps

N° du produit ABIN629692

Détail du produit anti-PPIF anticorps

Antigène: PPIF (Peptidylprolyl Isomerase F (PPIF))

Reactivité: Humain, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PPIF est non-conjugé

Application: Western Blotting (WB)

Purification: Purified

Immunogène: PPIF antibody was raised using a synthetic peptide corresponding to a region with amino acids GSTFHRVIPSFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVLS

Information d'application

Indications d'application: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PPIF Blocking Peptide, catalog no. 33R-3589, is also available for use as a blocking control in assays to test for specificity of this PPIF antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPIF antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PPIF

Antigène: PPIF (Peptidylprolyl Isomerase F (PPIF))

Autre désignation: PPIF (PPIF Produits)

Synonymes: anticorps CYP3, anticorps CyP-M, anticorps Cyp-D, anticorps CypD, anticorps CyP-D, anticorps ppif, anticorps wu:fd61c06, anticorps zgc:101753, anticorps AW457192, anticorps CyP-F, anticorps PPIase, anticorps Cyp-40, anticorps cypf, anticorps peptidylprolyl isomerase F, anticorps peptidylprolyl isomerase Fa, anticorps peptidylprolyl isomerase F (cyclophilin F), anticorps peptidylprolyl isomerase D, anticorps peptidylprolyl isomerase F L homeolog, anticorps PPIF, anticorps ppifa, anticorps Ppif, anticorps Ppid, anticorps ppif, anticorps ppif.L

Sujet: PPIF is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein is part of the mitochondrial permeability transition pore in the inner mitochondrial membrane. Activation of this pore is thought to be involved in the induction of apoptotic and necrotic cell death.

Poids moléculaire: 19 kDa (MW of target protein)

Pathways: Proton Transport, Negative Regulation of intrinsic apoptotic Signaling, Negative Regulation of Transporter Activity