AADAT anticorps (N-Term)

N° du produit ABIN629693

Détail du produit anti-AADAT anticorps

Antigène: AADAT (Aminoadipate Aminotransferase (AADAT))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp AADAT est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: AADAT antibody was raised against the N terminal of AADAT

Purification: Purified

Immunogène: AADAT antibody was raised using the N terminal of AADAT corresponding to a region with amino acids AVITVENGKTIQFGEEMMKRALQYSPSAGIPELLSWLKQLQIKLHNPPTI

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

AADAT Blocking Peptide, catalog no. 33R-1601, is also available for use as a blocking control in assays to test for specificity of this AADAT antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AADAT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur AADAT

Antigène: AADAT (Aminoadipate Aminotransferase (AADAT))

Autre désignation: AADAT (AADAT Produits)

Synonymes: anticorps KAT2, anticorps KATII, anticorps AI875679, anticorps Aadt, anticorps Kat2, anticorps mKat-2, anticorps MGC80030, anticorps kat2, anticorps katii, anticorps aminoadipate aminotransferase, anticorps aminoadipate aminotransferase S homeolog, anticorps AADAT, anticorps Aadat, anticorps aadat.S, anticorps aadat

Sujet: AADAT is a protein that is highly similar to mouse and rat kynurenine aminotransferase II. The rat protein is a homodimer with two transaminase activities. One activity is the transamination of alpha-aminoadipic acid, a final step in the saccaropine pathway which is the major pathway for L-lysine catabolism. The other activity involves the transamination of kynurenine to produce kynurenine acid, the precursor of kynurenic acid which has neuroprotective properties.

Poids moléculaire: 47 kDa (MW of target protein)