CA8 anticorps (N-Term)

N° du produit ABIN629695

Détail du produit anti-CA8 anticorps

Antigène: CA8 (Carbonic Anhydrase VIII (CA8))

Épitope: N-Term

Reactivité: Humain, Souris, Rat, Chien, Poisson zèbre (Danio rerio)

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CA8 est non-conjugé

Application: Western Blotting (WB)

Specificité: Carbonic Anhydrase VIII antibody was raised against the N terminal of CA8

Purification: Purified

Immunogène: Carbonic Anhydrase VIII antibody was raised using the N terminal of CA8 corresponding to a region with amino acids YEEGVEWGLVFPDANGEYQSPINLNSREARYDPSLLDVRLSPNYVVCRDC

Information d'application

Indications d'application: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Carbonic Anhydrase VIII Blocking Peptide, catalog no. 33R-10083, is also available for use as a blocking control in assays to test for specificity of this Carbonic Anhydrase VIII antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CA8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CA8

Antigène: CA8 (Carbonic Anhydrase VIII (CA8))

Autre désignation: Carbonic Anhydrase VIII (CA8 Produits)

Synonymes: anticorps AW546993, anticorps Ca8, anticorps Cals, anticorps Cals1, anticorps Carp, anticorps wdl, anticorps zgc:110118, anticorps CA-VIII, anticorps CALS, anticorps CAMRQ3, anticorps CARP, anticorps carbonic anhydrase 8, anticorps carbonic anhydrase VIII, anticorps CAH8, anticorps Car8, anticorps ca8, anticorps CA8

Sujet: CA8 was initially named CA-related protein because of sequence similarity to other known carbonic anhydrase genes. However, CA8 lacks carbonic anhydrase activity (i.e., the reversible hydration of carbon dioxide). CA8 continues to carry a carbonic anhydrase designation based on clear sequence identity to other members of the carbonic anhydrase gene family.

Poids moléculaire: 32 kDa (MW of target protein)