PCK1 anticorps (Soluble)

N° du produit ABIN629697

Détail du produit anti-PCK1 anticorps

Antigène: PCK1 (phosphoenolpyruvate Carboxykinase 1 (Soluble) (PCK1))

Épitope: Soluble

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PCK1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Purified

Immunogène: PCK1 antibody was raised using a synthetic peptide corresponding to a region with amino acids NGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPLAS

Information d'application

Indications d'application: WB: 0.2-1 µg/mL, IHC: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PCK1 Blocking Peptide, catalog no. 33R-6700, is also available for use as a blocking control in assays to test for specificity of this PCK1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCK1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PCK1

Antigène: PCK1 (phosphoenolpyruvate Carboxykinase 1 (Soluble) (PCK1))

Autre désignation: PCK1 (PCK1 Produits)

Synonymes: anticorps PEPCK-C, anticorps PEPCK1, anticorps PEPCKC, anticorps PEPCK, anticorps PEPCK-M, anticorps PEPCK2, anticorps 1810010O14Rik, anticorps 9130022B02Rik, anticorps cb856, anticorps cb924, anticorps fj93h11, anticorps zgc:63869, anticorps wu:fc51c05, anticorps wu:fj93h11, anticorps pepck-c, anticorps pepck1, anticorps pepckc, anticorps PCK1, anticorps PPCK1, anticorps AI265463, anticorps Pck-1, anticorps GTP, anticorps PCK, anticorps Pepck, anticorps RATPEPCK, anticorps Ppc1C, anticorps PHOSPHOENOLPYRUVATE CARBOXYKINASE, anticorps T28I19.150, anticorps T28I19_150, anticorps phosphoenolpyruvate carboxykinase 1, anticorps 143299_at, anticorps CG10924, anticorps CG17725, anticorps Dmel\\CG17725, anticorps Dromel_CG17725_FBtr0086701_pepck_mORF, anticorps dPEPCK, anticorps pepck, anticorps PEPC, anticorps PEPCase, anticorps ppc, anticorps phosphoenolpyruvate carboxykinase 1, anticorps phosphoenolpyruvate carboxykinase 2, mitochondrial, anticorps phosphoenolpyruvate carboxykinase 2 (mitochondrial), anticorps phosphoenolpyruvate carboxykinase 1 (soluble), anticorps phosphoenolpyruvate carboxykinase 1 S homeolog, anticorps phosphoenolpyruvate carboxykinase, cytosolic [GTP], anticorps phosphoenolpyruvate carboxykinase 1, cytosolic, anticorps phosphoenolpyruvate carboxylase 7, anticorps Phosphoenolpyruvate carboxykinase, anticorps phosphoenolpyruvate carboxylase, anticorps PCK1, anticorps PCK2, anticorps Pck2, anticorps pck1, anticorps pck1.S, anticorps LOC100634531, anticorps Pck1, anticorps pep7, anticorps Pepck, anticorps LOC107777405

Sujet: PCK1 is a main control point for the regulation of gluconeogenesis. The cytosolic enzyme encoded by this gene, along with GTP, catalyzes the formation of phosphoenolpyruvate from oxaloacetate, with the release of carbon dioxide and GDP. The expression of PCK1 can be regulated by insulin, glucocorticoids, glucagon, cAMP, and diet.

Poids moléculaire: 69 kDa (MW of target protein)

Pathways: Positive Regulation of Peptide Hormone Secretion, Carbohydrate Homeostasis