CDR2 anticorps (N-Term)

N° du produit ABIN629700

Détail du produit anti-CDR2 anticorps

Antigène: CDR2 (Cerebellar Degeneration-Related Protein 2, 62kDa (CDR2))

Épitope: N-Term

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CDR2 est non-conjugé

Application: Immunohistochemistry (IHC), Western Blotting (WB)

Specificité: CDR2 antibody was raised against the N terminal of CDR2

Purification: Purified

Immunogène: CDR2 antibody was raised using the N terminal of CDR2 corresponding to a region with amino acids MLAENLVEEFEMKEDEPWYDHQDLQQDLQLAAELGKTLLDRNTELEDSVQ

Information d'application

Indications d'application: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CDR2 Blocking Peptide, catalog no. 33R-6176, is also available for use as a blocking control in assays to test for specificity of this CDR2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDR2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CDR2

Antigène: CDR2 (Cerebellar Degeneration-Related Protein 2, 62kDa (CDR2))

Autre désignation: CDR2 (CDR2 Produits)

Synonymes: anticorps CDR62, anticorps Yo, anticorps cdr2, anticorps MGC69206, anticorps CDR2, anticorps AA617262, anticorps RGD1310578, anticorps cerebellar degeneration related protein 2, anticorps cerebellar degeneration related protein 2 L homeolog, anticorps cerebellar degeneration-related 2, anticorps cerebellar degeneration-related protein 2, anticorps cerebellar degeneration related protein 2 like, anticorps CDR2, anticorps cdr2, anticorps cdr2.L, anticorps Cdr2, anticorps CDR2L, anticorps LOC101060399

Sujet: Cdr2 normally sequesters c-Myc in the neuronal cytoplasm, thereby down-regulating c-Myc activity, and suggest a mechanism whereby inhibition of cdr2 function by autoantibodies in PCD may contribute to Purkinje neuronal.

Poids moléculaire: 52 kDa (MW of target protein)