RGS20 anticorps (N-Term)

N° du produit ABIN629702

Détail du produit anti-RGS20 anticorps

Antigène: RGS20 (Regulator of G-Protein Signaling 20 (RGS20))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RGS20 est non-conjugé

Application: Western Blotting (WB)

Specificité: RGS20 antibody was raised against the N terminal of RGS20

Purification: Purified

Immunogène: RGS20 antibody was raised using the N terminal of RGS20 corresponding to a region with amino acids KHFSRPSIWTQFLPLFRAQRYNTDIHQITENEGDLRAVPDIKSFPPAQLP

Information d'application

Indications d'application: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RGS20 Blocking Peptide, catalog no. 33R-4413, is also available for use as a blocking control in assays to test for specificity of this RGS20 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RGS20 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RGS20

Antigène: RGS20 (Regulator of G-Protein Signaling 20 (RGS20))

Autre désignation: RGS20 (RGS20 Produits)

Synonymes: anticorps RGSZ1, anticorps ZGAP1, anticorps zgc:92650, anticorps rgsz1, anticorps zgap1, anticorps GzGAP, anticorps RSG20, anticorps 2900073E09Rik, anticorps Rgsz1, anticorps regulator of G protein signaling 20, anticorps regulator of G-protein signaling 20 L homeolog, anticorps regulator of G-protein signaling 20, anticorps RGS20, anticorps rgs20, anticorps rgs20.L, anticorps Rgs20

Sujet: Regulator of G protein signaling (RGS) proteins are regulatory and structural components of G protein-coupled receptor complexes. RGS proteins are GTPase-activating proteins for Gi and Gq class G-alpha proteins. They accelerate transit through the cycle of GTP binding and hydrolysis and thereby accelerate signaling kinetics and termination.

Poids moléculaire: 44 kDa (MW of target protein)

Pathways: Myometrial Relaxation and Contraction, Regulation of G-Protein Coupled Receptor Protein Signaling