FECH anticorps

N° du produit ABIN629703

Détail du produit anti-FECH anticorps

Antigène: FECH (Ferrochelatase (FECH))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FECH est non-conjugé

Application: Western Blotting (WB)

Purification: Purified

Immunogène: FECH antibody was raised using a synthetic peptide corresponding to a region with amino acids LDRDLMTLPIQNKLAPFIAKRRTPKIQEQYRRIGGGSPIKIWTSKQGEGM

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FECH Blocking Peptide, catalog no. 33R-4860, is also available for use as a blocking control in assays to test for specificity of this FECH antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FECH antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FECH

Antigène: FECH (Ferrochelatase (FECH))

Autre désignation: FECH (FECH Produits)

Synonymes: anticorps AI894116, anticorps Fcl, anticorps fch, anticorps zgc:109851, anticorps EPP, anticorps FCE, anticorps CG2098, anticorps Dmel\\CG2098, anticorps GB15952, anticorps ferrochelatase L homeolog, anticorps ferrochelatase, anticorps Ferrochelatase, anticorps ferrochelatase, mitochondrial, anticorps ferrochelatase HemH, anticorps ferrochelatase (predicted), anticorps fech.L, anticorps hemH, anticorps Fech, anticorps FECH, anticorps fech, anticorps FeCH, anticorps LOC409922, anticorps hem15, anticorps APH_RS01140

Sujet: Ferrochelatase is localized to the mitochondrion where it catalyzes the insertion of the ferrous form of iron into protoporphyrin IX in the heme synthesis pathway. Defects in ferrochelatase are associated with protoporphyria.Ferrochelatase is localized to the mitochondrion where it catalyzes the insertion of the ferrous form of iron into protoporphyrin IX in the heme synthesis pathway. Defects in ferrochelatase are associated with protoporphyria. Two transcript variants encoding different isoforms have been found for this gene.

Poids moléculaire: 47 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis