FDFT1 anticorps (N-Term)
-
- Antigène Voir toutes FDFT1 Anticorps
- FDFT1 (Farnesyl-Diphosphate Farnesyltransferase 1 (FDFT1))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp FDFT1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- FDFT1 antibody was raised against the N terminal of FDFT1
- Purification
- Purified
- Immunogène
- FDFT1 antibody was raised using the N terminal of FDFT1 corresponding to a region with amino acids HSFLYQPDWRFMESKEKDRQVLEDFPTISLEFRNLAEKYQTVIADICRRM
- Top Product
- Discover our top product FDFT1 Anticorps primaire
-
-
- Indications d'application
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
FDFT1 Blocking Peptide, catalog no. 33R-3852, is also available for use as a blocking control in assays to test for specificity of this FDFT1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FDFT1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- FDFT1 (Farnesyl-Diphosphate Farnesyltransferase 1 (FDFT1))
- Autre désignation
- FDFT1 (FDFT1 Produits)
- Synonymes
- anticorps FDFT1, anticorps DKFZp459C1712, anticorps SQS, anticorps SS, anticorps DGPT, anticorps ERG9, anticorps fdft1, anticorps farnesyl-diphosphate farnesyltransferase 1, anticorps squalene synthase, anticorps farnesyl diphosphate farnesyl transferase 1, anticorps FDFT1, anticorps fdft1, anticorps LOC100560926, anticorps Fdft1
- Sujet
- FDFT1 is a membrane-associated enzyme located at a branch point in the mevalonate pathway. The protein is the first specific enzyme in cholesterol biosynthesis, catalyzing the dimerization of two molecules of farnesyl diphosphate in a two-step reaction to form squalene.
- Poids moléculaire
- 48 kDa (MW of target protein)
- Pathways
- Regulation of Lipid Metabolism by PPARalpha
-