HMGCS2 anticorps

N° du produit ABIN629710

Détail du produit anti-HMGCS2 anticorps

Antigène: HMGCS2 (3-Hydroxy-3-Methylglutaryl-CoA Synthase 2 (Mitochondrial) (HMGCS2))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HMGCS2 est non-conjugé

Application: Western Blotting (WB)

Purification: Purified

Immunogène: HMGCS2 antibody was raised using a synthetic peptide corresponding to a region with amino acids PKDVGILALEVYFPAQYVDQTDLEKYNNVEAGKYTVGLGQTRMGFCSVQE

Information d'application

Indications d'application: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HMGCS2 Blocking Peptide, catalog no. 33R-7166, is also available for use as a blocking control in assays to test for specificity of this HMGCS2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HMGCS2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HMGCS2

Antigène: HMGCS2 (3-Hydroxy-3-Methylglutaryl-CoA Synthase 2 (Mitochondrial) (HMGCS2))

Autre désignation: HMGCS2 (HMGCS2 Produits)

Synonymes: anticorps 1300002P16, anticorps mHS, anticorps DDBDRAFT_0219349, anticorps DDBDRAFT_0219924, anticorps DDB_0219349, anticorps DDB_0219924, anticorps Hmgcs1, anticorps Mt3h3mg, anticorps hmgCoA, anticorps 3-hydroxy-3-methylglutaryl-CoA synthase 2, anticorps 3-hydroxy-3-methylglutaryl-Coenzyme A synthase 2, anticorps hydroxymethylglutaryl-CoA synthase, anticorps hydroxymethylglutaryl-coa synthase, anticorps 3-HYDROXY-3-METHYLGLUTARYL-CoA SYNTHASE 2, anticorps HMGCS2, anticorps Hmgcs2, anticorps mvaS, anticorps CNC05080, anticorps HMCS1, anticorps hgsA, anticorps MFER_RS00425, anticorps LOC100285783, anticorps ECU10_0510, anticorps Eint_100450

Sujet: HMGCS2 condenses acetyl-CoA with acetoacetyl-CoA to form HMG-CoA, which is the substrate for HMG-CoA reductase.

Poids moléculaire: 56 kDa (MW of target protein)

Pathways: Response to Growth Hormone Stimulus, Cellular Response to Molecule of Bacterial Origin, Regulation of Lipid Metabolism by PPARalpha