FTCD anticorps (N-Term)

N° du produit ABIN629713

Détail du produit anti-FTCD anticorps

Antigène: FTCD (Formiminotransferase Cyclodeaminase (FTCD))

Épitope: N-Term

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FTCD est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: FTCD antibody was raised against the N terminal of FTCD

Purification: Purified

Immunogène: FTCD antibody was raised using the N terminal of FTCD corresponding to a region with amino acids FSEGKNQEVIDAISGAITQTPGCVLLDVDAGPSTNRTVYTFVGPPECVVE

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FTCD Blocking Peptide, catalog no. 33R-3055, is also available for use as a blocking control in assays to test for specificity of this FTCD antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FTCD antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FTCD

Antigène: FTCD (Formiminotransferase Cyclodeaminase (FTCD))

Autre désignation: FTCD (FTCD Produits)

Synonymes: anticorps LCHC1, anticorps FTCD, anticorps wu:fp37b11, anticorps zgc:63647, anticorps formimidoyltransferase cyclodeaminase, anticorps formiminotransferase cyclodeaminase, anticorps formiminotransferase-cyclodeaminase, anticorps formimidoyltransferase cyclodeaminase L homeolog, anticorps FTCD, anticorps Ftcd, anticorps ftcd, anticorps DP2350, anticorps Cbei_0990, anticorps TRQ2_1223, anticorps GAU_0899, anticorps ftcd.L

Sujet: FTCD is a bifunctional enzyme that channels 1-carbon units from formiminoglutamate, a metabolite of the histidine degradation pathway, to the folate pool.FTCD is a bifunctional enzyme that channels 1-carbon units from formiminoglutamate, a metabolite of the histidine degradation pathway, to the folate pool.

Poids moléculaire: 60 kDa (MW of target protein)