RSU1 anticorps (C-Term)
-
- Antigène Voir toutes RSU1 Anticorps
- RSU1 (Ras Suppressor Protein 1 (RSU1))
-
Épitope
- C-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp RSU1 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificité
- RSU1 antibody was raised against the C terminal of RSU1
- Purification
- Purified
- Immunogène
- RSU1 antibody was raised using the C terminal of RSU1 corresponding to a region with amino acids PIADQFQLGVSHVFEYIRSETYKYLYGRHMQANPEPPKKNNDKSKKISRK
- Top Product
- Discover our top product RSU1 Anticorps primaire
-
anti-Ras Suppressor Protein 1 (RSU1) antibody
RSU1 Reactivité: Humain, Souris, Rat WB, ELISA, IHC Hôte: Lapin Polyclonal unconjugated
anti-Ras Suppressor Protein 1 (RSU1) (AA 2-277) antibodyRSU1 Reactivité: Humain WB, IHC, IP, ICC Hôte: Lapin Polyclonal unconjugated
anti-Ras Suppressor Protein 1 (RSU1) (AA 178-277) antibodyRSU1 Reactivité: Humain WB, ELISA Hôte: Souris Monoclonal 3F10 unconjugated
anti-Ras Suppressor Protein 1 (RSU1) (AA 1-277) antibodyRSU1 Reactivité: Humain WB, ELISA Hôte: Souris Monoclonal 1C6 unconjugated
anti-Ras Suppressor Protein 1 (RSU1) (C-Term) antibodyRSU1 Reactivité: Humain, Souris WB, ELISA, ICC, IF Hôte: Lapin Polyclonal unconjugated
anti-Ras Suppressor Protein 1 (RSU1) (C-Term) antibodyRSU1 Reactivité: Humain, Souris, Rat, Boeuf (Vache), Chien, Cobaye, Cheval, Poulet, Hamster, Singe, Xenopus laevis WB, IHC, IHC (p) Hôte: Lapin Polyclonal unconjugated
anti-Ras Suppressor Protein 1 (RSU1) (C-Term) antibodyRSU1 Reactivité: Humain, Souris, Rat, Boeuf (Vache), Chien, Cobaye, Cheval, Lapin, Mouton, Poisson zèbre (Danio rerio) WB, IHC Hôte: Lapin Polyclonal unconjugated
anti-Ras Suppressor Protein 1 (RSU1) (AA 117-277) antibodyRSU1 Reactivité: Humain WB, ELISA Hôte: Lapin Polyclonal unconjugated
anti-Ras Suppressor Protein 1 (RSU1) (AA 1-277) antibodyRSU1 Reactivité: Humain WB, ELISA Hôte: Souris Polyclonal unconjugated
anti-Ras Suppressor Protein 1 (RSU1) antibodyRSU1 Reactivité: Humain, Souris, Rat WB Hôte: Lapin Polyclonal unconjugated
-
- Indications d'application
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
RSU1 Blocking Peptide, catalog no. 33R-7149, is also available for use as a blocking control in assays to test for specificity of this RSU1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RSU1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- RSU1 (Ras Suppressor Protein 1 (RSU1))
- Autre désignation
- RSU1 (RSU1 Produits)
- Synonymes
- anticorps etID12695, anticorps si:dz63m2.1, anticorps RSP-1, anticorps RsuI, anticorps rsp-1, anticorps Ras suppressor protein 1, anticorps Ras suppressor protein 1 S homeolog, anticorps rsu1, anticorps rsu1.S, anticorps RSU1, anticorps Rsu1
- Sujet
- RSU1 is a protein that is involved in the Ras signal transduction pathway, growth inhibition, and nerve-growth factor induced differentiation processes, as determined in mouse and human cell line studies. In mouse, the protein was initially isolated based on its ability to inhibit v-Ras transformation.
- Poids moléculaire
- 31 kDa (MW of target protein)
-
