Asialoglycoprotein Receptor 2 anticorps (N-Term)

N° du produit ABIN629718

Détail du produit anti-Asialoglycoprotein Receptor 2 anticorps

Antigène: Asialoglycoprotein Receptor 2 (ASGR2)

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Asialoglycoprotein Receptor 2 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: ASGR2 antibody was raised against the N terminal of ASGR2

Purification: Purified

Immunogène: ASGR2 antibody was raised using the N terminal of ASGR2 corresponding to a region with amino acids STLTEVQAISTHGGSVGDKITSLGAKLEKQQQDLKADHDALLFHLKHFPV

Information d'application

Indications d'application: WB: 4 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ASGR2 Blocking Peptide, catalog no. 33R-8876, is also available for use as a blocking control in assays to test for specificity of this ASGR2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ASGR2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Asialoglycoprotein Receptor 2

Antigène: Asialoglycoprotein Receptor 2 (ASGR2)

Autre désignation: ASGR2 (ASGR2 Produits)

Synonymes: anticorps ASGR2, anticorps asgr2, anticorps MGC137129, anticorps ASGP-R2, anticorps ASGPR2, anticorps CLEC4H2, anticorps HBXBP, anticorps HL-2, anticorps Asgr, anticorps Asgr-2, anticorps asialoglycoprotein receptor 2, anticorps C-type lectin domain family 10 member A, anticorps ASGR2, anticorps clec10a, anticorps Asgr2, anticorps LOC100347178

Sujet: ASGR2 is a cell surface receptor that binds to galactose-terminated glycoproteins. It transports these glycoproteins via a series of membrane vesicles and tubules to an acidic-sorting organelle where the receptor and ligand dissociates. Then the receptor is recycled back to the cell surface. There are four alternatively spliced transcript variants of this gene. This gene has multiple polyadenylation sites.

Poids moléculaire: 34 kDa (MW of target protein)

Pathways: Thyroid Hormone Synthesis