UBE2N anticorps

N° du produit ABIN629720

Détail du produit anti-UBE2N anticorps

Antigène: UBE2N (Ubiquitin-Conjugating Enzyme E2N (UBE2N))

Reactivité: Humain, Rat, Souris, Poisson zèbre (Danio rerio), Chien, Drosophila melanogaster

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp UBE2N est non-conjugé

Application: Western Blotting (WB)

Purification: Purified

Immunogène: UBE2 N antibody was raised using a synthetic peptide corresponding to a region with amino acids GRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNE

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

UBE2N Blocking Peptide, catalog no. 33R-3532, is also available for use as a blocking control in assays to test for specificity of this UBE2N antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBE0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur UBE2N

Antigène: UBE2N (Ubiquitin-Conjugating Enzyme E2N (UBE2N))

Autre désignation: UBE2N (UBE2N Produits)

Synonymes: anticorps UBC13, anticorps UbcH-ben, anticorps UbcH13, anticorps 1500026J17Rik, anticorps AL022654, anticorps BB101821, anticorps ube2n, anticorps wu:fb11b03, anticorps wu:fc08b06, anticorps zgc:55726, anticorps ubc13, anticorps ubch-ben, anticorps UBE2N, anticorps ube2nl, anticorps zgc:63901, anticorps ubiquitin conjugating enzyme E2 N, anticorps ubiquitin-conjugating enzyme E2N, anticorps ubiquitin conjugating enzyme E2 N S homeolog, anticorps ubiquitin-conjugating enzyme E2Na, anticorps ubiquitin-conjugating enzyme E2Nb, anticorps UBE2N, anticorps Ube2n, anticorps ube2n.S, anticorps ube2na, anticorps LOC100533434, anticorps ube2n, anticorps ube2nb

Sujet: UBE2N encodes a member of the E2 ubiquitin-conjugating enzyme family. The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. Studies in mouse suggest that this protein plays a role in DNA postreplication repair.

Poids moléculaire: 17 kDa (MW of target protein)

Pathways: TCR Signaling, Fc-epsilon Receptor Signaling Pathway, Activation of Innate immune Response, Toll-Like Receptors Cascades, Positive Regulation of Response to DNA Damage Stimulus, Ubiquitin Proteasome Pathway