UBE2K anticorps (N-Term)

N° du produit ABIN629721

Détail du produit anti-UBE2K anticorps

Antigène: UBE2K (Ubiquitin-Conjugating Enzyme E2K (UBE2K))

Épitope: N-Term

Reactivité: Humain, Souris, Rat, Poisson zèbre (Danio rerio), Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp UBE2K est non-conjugé

Application: Western Blotting (WB)

Specificité: HIP2 antibody was raised against the N terminal of HIP2

Purification: Purified

Immunogène: HIP2 antibody was raised using the N terminal of HIP2 corresponding to a region with amino acids MANIAVQRIKREFKEVLKSEETSKNQIKVDLVDENFTELRGEIAGPPDTP

Information d'application

Indications d'application: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HIP2 Blocking Peptide, catalog no. 33R-5707, is also available for use as a blocking control in assays to test for specificity of this HIP2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HIP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur UBE2K

Antigène: UBE2K (Ubiquitin-Conjugating Enzyme E2K (UBE2K))

Autre désignation: HIP2 (UBE2K Produits)

Synonymes: anticorps E2-25K, anticorps HIP2, anticorps HYPG, anticorps LIG, anticorps UBC1, anticorps E2-25k, anticorps Hip2, anticorps Hypg, anticorps Lig, anticorps e2-25k, anticorps hip2, anticorps hypg, anticorps lig, anticorps AW492011, anticorps D5Ertd601e, anticorps ube2k, anticorps zgc:103472, anticorps zgc:110791, anticorps ubiquitin conjugating enzyme E2 K, anticorps ubiquitin-conjugating enzyme E2K, anticorps ubiquitin conjugating enzyme E2 K S homeolog, anticorps ubiquitin-conjugating enzyme E2Kb (UBC1 homolog, yeast), anticorps ubiquitin-conjugating enzyme E2Ka (UBC1 homolog, yeast), anticorps UBE2K, anticorps Ube2k, anticorps ube2k.S, anticorps ube2k, anticorps ube2kb, anticorps ube2ka

Sujet: HIP2 belongs to the ubiquitin-conjugating enzyme family. It binds selectively to a large region at the N terminus of huntingtin. This interaction is not influenced by the length of the huntingtin polyglutamine tract. This protein has been implicated in the degradation of huntingtin and suppression of apoptosis.

Poids moléculaire: 22 kDa (MW of target protein)