RNF165 anticorps (N-Term)
-
- Antigène Voir toutes RNF165 Anticorps
- RNF165 (Ring Finger Protein 165 (RNF165))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp RNF165 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- RNF165 antibody was raised against the N terminal of RNF165
- Purification
- Purified
- Immunogène
- RNF165 antibody was raised using the N terminal of RNF165 corresponding to a region with amino acids MVLVHVGYLVLPVFGSVRNRGAPFQRSQHPHATSCRHFHLGPPQPQQLAP
- Top Product
- Discover our top product RNF165 Anticorps primaire
-
anti-Ring Finger Protein 165 (RNF165) (Middle Region) antibody
RNF165 Reactivité: Humain, Souris, Rat, Chien WB, IHC Hôte: Lapin Polyclonal unconjugated
anti-Ring Finger Protein 165 (RNF165) (Middle Region) antibodyRNF165 Reactivité: Humain, Souris, Rat, Chien, Cobaye, Cheval, Lapin, Boeuf (Vache), Poisson zèbre (Danio rerio) WB, IHC Hôte: Lapin Polyclonal unconjugated
anti-Ring Finger Protein 165 (RNF165) (AA 3-31), (N-Term) antibodyRNF165 Reactivité: Humain WB Hôte: Lapin Polyclonal RB37753 unconjugated
anti-Ring Finger Protein 165 (RNF165) (N-Term) antibodyRNF165 Reactivité: Humain, Souris, Rat, Cobaye, Cheval, Lapin, Poulet, Singe, Roussette (Chauve-souris) WB Hôte: Lapin Polyclonal unconjugated
anti-Ring Finger Protein 165 (RNF165) (AA 201-250) antibodyRNF165 Reactivité: Humain, Souris, Rat, Chien, Cobaye, Cheval, Lapin, Boeuf (Vache), Poulet, Singe, Porc WB, IHC, IHC (p) Hôte: Lapin Polyclonal unconjugated
-
- Indications d'application
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
RNF165 Blocking Peptide, catalog no. 33R-6596, is also available for use as a blocking control in assays to test for specificity of this RNF165 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF165 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- RNF165 (Ring Finger Protein 165 (RNF165))
- Autre désignation
- RNF165 (RNF165 Produits)
- Synonymes
- anticorps RNF165, anticorps ARKL2, anticorps 2900024M11Rik, anticorps AI427432, anticorps G630064H08Rik, anticorps Gm96, anticorps RGD1560744, anticorps si:ch73-29c22.3, anticorps ring finger protein 165, anticorps ring finger protein 165a, anticorps RNF165, anticorps Rnf165, anticorps rnf165a
- Sujet
- RNF165 is encoded in regions involved in pericentric inversions in patients with bipolar affective disorder.Encoded in regions involved in pericentric inversions in patients with bipolar affective disorder.Encoded in regions involved in pericentric inversions in patients with bipolar affective disorder.
- Poids moléculaire
- 39 kDa (MW of target protein)
-
