BSDC1 anticorps (N-Term)

N° du produit ABIN629726

Détail du produit anti-BSDC1 anticorps

Antigène: BSDC1 (BSD Domain Containing 1 (BSDC1))

Épitope: N-Term

Reactivité: Humain, Souris, Chien, Rat, Poisson zèbre (Danio rerio)

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp BSDC1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: BSDC1 antibody was raised against the N terminal of BSDC1

Purification: Purified

Immunogène: BSDC1 antibody was raised using the N terminal of BSDC1 corresponding to a region with amino acids VISDTFAPSPDKTIDCDVITLMGTPSGTAEPYDGTKARLYSLQSDPATYC

Information d'application

Indications d'application: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

BSDC1 Blocking Peptide, catalog no. 33R-9610, is also available for use as a blocking control in assays to test for specificity of this BSDC1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BSDC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur BSDC1

Antigène: BSDC1 (BSD Domain Containing 1 (BSDC1))

Autre désignation: BSDC1 (BSDC1 Produits)

Synonymes: anticorps BSDC1, anticorps fb51h12, anticorps wu:fb51h12, anticorps zgc:100785, anticorps bsdc1, anticorps 1110063F24Rik, anticorps AW011758, anticorps RGD1311622, anticorps BSD domain containing 1, anticorps BSD domain containing 1 L homeolog, anticorps BSDC1, anticorps bsdc1, anticorps bsdc1.L, anticorps Bsdc1

Sujet: BSDC1 may be involved in protein binding.

Poids moléculaire: 17 kDa (MW of target protein)