UBR7 anticorps (C-Term)

N° du produit ABIN629727

Détail du produit anti-UBR7 anticorps

Antigène: UBR7 (Ubiquitin Protein Ligase E3 Component N-Recognin 7 (UBR7))

Épitope: C-Term

Reactivité: Humain, Rat, Souris, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp UBR7 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: C14 ORF130 antibody was raised against the C terminal Of C14 rf130

Purification: Purified

Immunogène: C14 ORF130 antibody was raised using the C terminal Of C14 rf130 corresponding to a region with amino acids DRSDPLMDTLSSMNRVQQVELICEYNDLKTELKDYLKRFADEGTVVKRED

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C14ORF130 Blocking Peptide, catalog no. 33R-2148, is also available for use as a blocking control in assays to test for specificity of this C14ORF130 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF130 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur UBR7

Antigène: UBR7 (Ubiquitin Protein Ligase E3 Component N-Recognin 7 (UBR7))

Autre désignation: C14ORF130 (UBR7 Produits)

Synonymes: anticorps C14orf130, anticorps 5730410I19Rik, anticorps AA589405, anticorps AW557761, anticorps RGD1359144, anticorps ubiquitin protein ligase E3 component n-recognin 7 (putative), anticorps UBR7, anticorps Ubr7

Sujet: The function of Chromosome 14 ORF protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 30 kDa (MW of target protein)