CDC23 anticorps

N° du produit ABIN629729

Détail du produit anti-CDC23 anticorps

Antigène: CDC23 (Cell Division Cycle 23 (CDC23))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CDC23 est non-conjugé

Application: Western Blotting (WB)

Purification: Purified

Immunogène: CDC23 antibody was raised using a synthetic peptide corresponding to a region with amino acids RAAHFLHGCNSKKAYFLYMYSRYLSGEKKKDDETVDSLGPLEKGQVKNEA

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CDC23 Blocking Peptide, catalog no. 33R-7799, is also available for use as a blocking control in assays to test for specificity of this CDC23 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDC23 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CDC23

Antigène: CDC23 (Cell Division Cycle 23 (CDC23))

Autre désignation: CDC23 (CDC23 Produits)

Synonymes: anticorps CDC23, anticorps anaphase-promoting complex subunit 8, anticorps zgc:56013, anticorps 6030435O18, anticorps D18Ertd243e, anticorps ANAPC8, anticorps APC8, anticorps CUT23, anticorps cell division cycle 23, anticorps cell division cycle protein 23 homolog, anticorps anaphase-promoting complex subunit 8, anticorps CDC23 (cell division cycle 23, yeast, homolog), anticorps cell division cycle 23 S homeolog, anticorps CDC23 cell division cycle 23, anticorps CDC23, anticorps LOC100162672, anticorps LOC100380698, anticorps APC8, anticorps cdc23, anticorps cdc23.S, anticorps Cdc23

Sujet: CDC23 shares strong similarity with Saccharomyces cerevisiae Cdc23, a protein essential for cell cycle progression through the G2/M transition. This protein is a component of anaphase-promoting complex (APC), which is composed of eight protein subunits and highly conserved in eukaryotic cells. APC catalyzes the formation of cyclin B-ubiquitin conjugate that is responsible for the ubiquitin-mediated proteolysis of B-type cyclins. This protein and 3 other members of the APC complex contain the TPR (tetratricopeptide repeat), a protein domain important for protein-protein interaction.

Poids moléculaire: 66 kDa (MW of target protein)

Pathways: Protein targeting to Nucleus