UBE2D1 anticorps

N° du produit ABIN629731

Détail du produit anti-UBE2D1 anticorps

Antigène: UBE2D1 (Ubiquitin-Conjugating Enzyme E2D 1 (UBE2D1))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp UBE2D1 est non-conjugé

Application: Western Blotting (WB)

Purification: Purified

Immunogène: UBE2 D1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SQWSPALTVSKVLLSICSLLCDPNPDDPLVPDIAQIYKSDKEKYNRHARE

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

UBE2D1 Blocking Peptide, catalog no. 33R-8734, is also available for use as a blocking control in assays to test for specificity of this UBE2D1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBE0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur UBE2D1

Antigène: UBE2D1 (Ubiquitin-Conjugating Enzyme E2D 1 (UBE2D1))

Autre désignation: UBE2D1 (UBE2D1 Produits)

Synonymes: anticorps E2(17)KB1, anticorps SFT, anticorps UBC4/5, anticorps UBCH5, anticorps UBCH5A, anticorps ube2d1, anticorps wu:fc16h06, anticorps zgc:73096, anticorps e2(17)kb1, anticorps sft, anticorps ubc4/5, anticorps ubch5, anticorps ubch5a, anticorps ubiquitin conjugating enzyme E2 D1, anticorps ubiquitin-conjugating enzyme E2D 1, anticorps ubiquitin-conjugating enzyme E2D 1b, anticorps ubiquitin conjugating enzyme E2 D1 S homeolog, anticorps UBE2D1, anticorps Ube2d1, anticorps ube2d1b, anticorps ube2d1.S, anticorps ube2d1

Sujet: The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. UBE2D1 is a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is closely related to a stimulator of iron transport (SFT), and is up-regulated in hereditary hemochromatosis. It also functions in the ubiquitination of the tumor-suppressor protein p53 and the hypoxia-inducible transcription factor HIF1alpha by interacting with the E1 ubiquitin-activating enzyme and the E3 ubiquitin-protein ligases.

Poids moléculaire: 16 kDa (MW of target protein)

Pathways: Activation of Innate immune Response, Toll-Like Receptors Cascades