RNF32 anticorps (Middle Region)
-
- Antigène Voir toutes RNF32 Anticorps
- RNF32 (Ring Finger Protein 32 (RNF32))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp RNF32 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- RNF32 antibody was raised against the middle region of RNF32
- Purification
- Purified
- Immunogène
- RNF32 antibody was raised using the middle region of RNF32 corresponding to a region with amino acids ACLQAFEKFTNKKTCPLCRKNQYQTRVIHDGARLFRIKCVTRIQAYWRGC
- Top Product
- Discover our top product RNF32 Anticorps primaire
-
anti-Ring Finger Protein 32 (RNF32) (AA 1-256) antibody
RNF32 Reactivité: Humain WB, IP Hôte: Lapin Polyclonal unconjugated
anti-Ring Finger Protein 32 (RNF32) (AA 1-256) antibodyRNF32 Reactivité: Humain WB, IHC (p) Hôte: Souris Polyclonal unconjugated
anti-Ring Finger Protein 32 (RNF32) (AA 1-235) antibodyRNF32 Reactivité: Humain WB Hôte: Souris Polyclonal unconjugated
anti-Ring Finger Protein 32 (RNF32) (AA 151-200) antibodyRNF32 Reactivité: Humain, Souris, Rat, Cheval, Porc, Lapin, Poisson zèbre (Danio rerio), Singe WB Hôte: Lapin Polyclonal unconjugated
-
- Indications d'application
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
RNF32 Blocking Peptide, catalog no. 33R-1073, is also available for use as a blocking control in assays to test for specificity of this RNF32 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF32 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- RNF32 (Ring Finger Protein 32 (RNF32))
- Autre désignation
- RNF32 (RNF32 Produits)
- Synonymes
- anticorps zgc:153042, anticorps FKSG33, anticorps HSD15, anticorps LMBR2, anticorps 1700009J01Rik, anticorps 2700025B22Rik, anticorps 4930542N22Rik, anticorps Lmbr2, anticorps ring finger protein 32, anticorps rnf32, anticorps RNF32, anticorps Rnf32
- Sujet
- RNF32 contains two RING ring finger motifs. RING finger motifs are present in a variety of functionally distinct proteins and are known to be involved in protein-DNA or protein-protein interactions. Its gene was found to be expressed during spermatogenesis, most likely in spermatocytes and/or in spermatids.
- Poids moléculaire
- 40 kDa (MW of target protein)
-
