DPYS anticorps (N-Term)

N° du produit ABIN629746

Détail du produit anti-DPYS anticorps

Antigène: DPYS (Dihydropyrimidinase (DPYS))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DPYS est non-conjugé

Application: Western Blotting (WB)

Specificité: DPYS antibody was raised against the N terminal of DPYS

Purification: Purified

Immunogène: DPYS antibody was raised using the N terminal of DPYS corresponding to a region with amino acids VLDAAGKLVLPGGIDTHTHMQFPFMGSRSIDDFHQGTKAALSGGTTMIID

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DPYS Blocking Peptide, catalog no. 33R-9643, is also available for use as a blocking control in assays to test for specificity of this DPYS antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DPYS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DPYS

Antigène: DPYS (Dihydropyrimidinase (DPYS))

Autre désignation: DPYS (DPYS Produits)

Synonymes: anticorps DHP, anticorps DHPase, anticorps 1200017I10Rik, anticorps 1300004I01Rik, anticorps dhp, anticorps dihydropyrimidinase, anticorps dihydropyrimidinase L homeolog, anticorps DPYS, anticorps Dpys, anticorps Jann_1488, anticorps hydA, anticorps h16_A3075, anticorps Veis_0725, anticorps AZC_1966, anticorps M446_2543, anticorps RSKD131_3628, anticorps Vapar_5601, anticorps Rleg_5687, anticorps LOC9307588, anticorps EIO_3239, anticorps blr3333, anticorps BAV0676, anticorps hyuA, anticorps CtCNB1_2936, anticorps dpyS, anticorps Pat9b_1914, anticorps dpys, anticorps dpys.L

Sujet: Dihydropyrimidinase catalyzes the conversion of 5,6-dihydrouracil to 3-ureidopropionate in pyrimidine metabolism. Dihydropyrimidinase is expressed at a high level in liver and kidney as a major 2.5-kb transcript and a minor 3.8-kb transcript. Defects in the DPYS gene are linked to dihydropyrimidinuria.Dihydropyrimidinase catalyzes the conversion of 5,6-dihydrouracil to 3-ureidopropionate in pyrimidine metabolism. Dihydropyrimidinase is expressed at a high level in liver and kidney as a major 2.5-kb transcript and a minor 3.8-kb transcript. Defects in the DPYS gene are linked to dihydropyrimidinuria.

Poids moléculaire: 56 kDa (MW of target protein)