BHMT anticorps (C-Term)
-
- Antigène Voir toutes BHMT Anticorps
- BHMT (Betaine--Homocysteine S-Methyltransferase (BHMT))
-
Épitope
- C-Term
-
Reactivité
- Humain, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp BHMT est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificité
- BHMT antibody was raised against the C terminal of BHMT
- Purification
- Purified
- Immunogène
- BHMT antibody was raised using the C terminal of BHMT corresponding to a region with amino acids KHGSWGSGLDMHTKPWVRARARKEYWENLRIASGRPYNPSMSKPDGWGVT
- Top Product
- Discover our top product BHMT Anticorps primaire
-
anti-Betaine--Homocysteine S-Methyltransferase (BHMT) (N-Term) antibody
BHMT Reactivité: Humain, Souris, Rat, Chien, Cobaye, Cheval, Boeuf (Vache), Lapin, Poisson zèbre (Danio rerio) WB, IHC Hôte: Lapin Polyclonal unconjugated
anti-Betaine--Homocysteine S-Methyltransferase (BHMT) (AA 177-406) antibodyBHMT Reactivité: Humain WB, IF Hôte: Lapin Polyclonal unconjugated
anti-Betaine--Homocysteine S-Methyltransferase (BHMT) (C-Term) antibodyVerified BHMT Reactivité: Humain, Souris, Rat WB, IHC, ELISA Hôte: Chèvre Polyclonal unconjugated
anti-Betaine--Homocysteine S-Methyltransferase (BHMT) antibodyBHMT Reactivité: Humain WB, IF, FACS Hôte: Souris Monoclonal 10B3 unconjugated
anti-Betaine--Homocysteine S-Methyltransferase (BHMT) (C-Term) antibodyBHMT Reactivité: Humain, Souris, Rat, Chien, Cobaye, Cheval, Boeuf (Vache), Lapin, Porc WB, IHC Hôte: Lapin Polyclonal unconjugated
anti-Betaine--Homocysteine S-Methyltransferase (BHMT) antibodyBHMT Reactivité: Humain IHC, ELISA Hôte: Souris Monoclonal 8C11H5 unconjugated
anti-Betaine--Homocysteine S-Methyltransferase (BHMT) antibodyBHMT Reactivité: Humain WB, IHC (p), IF, ICC Hôte: Lapin Polyclonal unconjugated
anti-Betaine--Homocysteine S-Methyltransferase (BHMT) (C-Term) antibodyBHMT Reactivité: Humain, Souris, Rat WB, IHC, ELISA Hôte: Lapin Polyclonal unconjugated
anti-Betaine--Homocysteine S-Methyltransferase (BHMT) (N-Term) antibodyBHMT Reactivité: Humain, Souris, Rat, Chien WB, IHC Hôte: Lapin Polyclonal unconjugated
anti-Betaine--Homocysteine S-Methyltransferase (BHMT) antibodyBHMT Reactivité: Humain, Souris WB, ELISA Hôte: Souris Monoclonal 3D6 unconjugated
-
- Indications d'application
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
BHMT Blocking Peptide, catalog no. 33R-4414, is also available for use as a blocking control in assays to test for specificity of this BHMT antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BHMT antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- BHMT (Betaine--Homocysteine S-Methyltransferase (BHMT))
- Autre désignation
- BHMT (BHMT Produits)
- Synonymes
- anticorps BHMT1, anticorps hm:zehn2153, anticorps wu:fb53h01, anticorps wu:fb63c08, anticorps wu:fj64d01, anticorps zgc:123027, anticorps betaine--homocysteine S-methyltransferase, anticorps betaine--homocysteine S-methyltransferase L homeolog, anticorps betaine-homocysteine methyltransferase, anticorps betaine-homocysteine S-methyltransferase, anticorps BHMT, anticorps bhmt.L, anticorps Bhmt, anticorps bhmt
- Sujet
- BHMT is a cytosolic enzyme that catalyzes the conversion of betaine and homocysteine to dimethylglycine and methionine, respectively. Defects in its gene could lead to hyperhomocyst(e)inemia, but such a defect has not yet been observed.
- Poids moléculaire
- 45 kDa (MW of target protein)
- Pathways
- Methionine Biosynthetic Process
-
