Cytokeratin 13 anticorps (C-Term)

N° du produit ABIN629751

Détail du produit anti-Cytokeratin 13 anticorps

Antigène: Cytokeratin 13 (KRT13) (Keratin 13 (KRT13))

Épitope: C-Term

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Cytokeratin 13 est non-conjugé

Application: Western Blotting (WB)

Specificité: Cytokeratin 13 antibody was raised against the C terminal of KRT13

Purification: Purified

Immunogène: Cytokeratin 13 antibody was raised using the C terminal of KRT13 corresponding to a region with amino acids EAQLSELRSEMECQNQEYKMLLDIKTRLEQEIATYRSLLEGQDAKKRQPP

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Cytokeratin 13 Blocking Peptide, catalog no. 33R-2277, is also available for use as a blocking control in assays to test for specificity of this Cytokeratin 13 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KRT13 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Cytokeratin 13

Antigène: Cytokeratin 13 (KRT13) (Keratin 13 (KRT13))

Autre désignation: Cytokeratin 13 (KRT13 Produits)

Synonymes: anticorps krt13, anticorps CK13, anticorps K13, anticorps Ka13, anticorps Krt-1.13, anticorps Krt1-13, anticorps ck13, anticorps k13, anticorps keratin 24, anticorps keratin 13, anticorps keratin 13, type I S homeolog, anticorps krt24, anticorps KRT13, anticorps Krt13, anticorps krt13.S, anticorps k13

Sujet: KRT13 is a member of the keratin gene family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. Most of the type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains. This type I cytokeratin is paired with keratin 4 and expressed in the suprabasal layers of non-cornified stratified epithelia.

Poids moléculaire: 46 kDa (MW of target protein)