HAL anticorps (C-Term)

N° du produit ABIN629752

Détail du produit anti-HAL anticorps

Antigène: HAL (Histidine Ammonia-Lyase (HAL))

Épitope: C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HAL est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: HAL antibody was raised against the C terminal of HAL

Purification: Purified

Immunogène: HAL antibody was raised using the C terminal of HAL corresponding to a region with amino acids EAAHRLLLEQKVWEVAAPYIEKYRMEHIPESRPLSPTAFSLQFLHKKSTK

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HAL Blocking Peptide, catalog no. 33R-2249, is also available for use as a blocking control in assays to test for specificity of this HAL antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HAL antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HAL

Antigène: HAL (Histidine Ammonia-Lyase (HAL))

Autre désignation: HAL (HAL Produits)

Synonymes: anticorps HIS, anticorps HSTD, anticorps hal, anticorps hstd, anticorps xhal, anticorps HAL, anticorps BA3712, anticorps DDBDRAFT_0187742, anticorps DDBDRAFT_0231727, anticorps DDB_0187742, anticorps DDB_0231727, anticorps zgc:136980, anticorps his, anticorps Hsd, anticorps histidase, anticorps histidine ammonia-lyase, anticorps histidine ammonia-lyase, gene 1 L homeolog, anticorps histidine ammonia-lyase HutH, anticorps histidine ammonia-lyase, gene 1, anticorps histidine ammonia lyase, anticorps HAL, anticorps hal.1.L, anticorps hutH, anticorps Tc00.1047053506247.220, anticorps Plav_1493, anticorps hal, anticorps hal.1, anticorps Hal

Sujet: HAL is a cytosolic enzyme catalyzing the first reaction in histidine catabolism, the nonoxidative deamination of L-histidine to trans-urocanic acid. HAL defects cause histidinemia which is characterized by increased histidine and histamine and decreased urocanic acid in body fluidsHistidine ammonia-lyase is a cytosolic enzyme catalyzing the first reaction in histidine catabolism, the nonoxidative deamination of L-histidine to trans-urocanic acid. Histidine ammonia-lyase defects cause histidinemia which is characterized by increased histidine and histamine and decreased urocanic acid in body fluids.

Poids moléculaire: 72 kDa (MW of target protein)