SBDS anticorps (C-Term)
-
- Antigène Voir toutes SBDS Anticorps
- SBDS (Shwachman-Bodian-Diamond Syndrome (SBDS))
-
Épitope
- C-Term
-
Reactivité
- Humain, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SBDS est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificité
- SBDS antibody was raised against the C terminal of SBDS
- Purification
- Purified
- Immunogène
- SBDS antibody was raised using the C terminal of SBDS corresponding to a region with amino acids DYGQQLEIVCLIDPGCFREIDELIKKETKGKGSLEVLNLKDVEEGDEKFE
- Top Product
- Discover our top product SBDS Anticorps primaire
-
-
- Indications d'application
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SBDS Blocking Peptide, catalog no. 33R-2237, is also available for use as a blocking control in assays to test for specificity of this SBDS antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SBDS antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SBDS (Shwachman-Bodian-Diamond Syndrome (SBDS))
- Autre désignation
- SBDS (SBDS Produits)
- Synonymes
- anticorps cgi-97, anticorps sds, anticorps swds, anticorps zgc:56700, anticorps SDS, anticorps SWDS, anticorps 4733401P19Rik, anticorps AI836084, anticorps CGI-97, anticorps SBDS ribosome assembly guanine nucleotide exchange factor, anticorps hypothetical protein, anticorps SBDS, ribosome maturation factor, anticorps SBDS ribosome assembly guanine nucleotide exchange factor S homeolog, anticorps SBDS ribosome maturation factor, anticorps sbds, anticorps LOAG_04440, anticorps sbds.S, anticorps SBDS, anticorps Sbds
- Sujet
- SBDS is a member of a highly conserved protein family that exists from archaea to vertebrates and plants. The protein may function in RNA metabolism. Mutations within its gene are associated with Shwachman-Bodian-Diamond syndrome.
- Poids moléculaire
- 28 kDa (MW of target protein)
- Pathways
- Ribonucleoprotein Complex Subunit Organization, Ribosome Assembly
-