GSTZ1 anticorps
-
- Antigène Voir toutes GSTZ1 Anticorps
- GSTZ1 (Glutathione Transferase zeta 1 (Maleylacetoacetate Isomerase) (GSTZ1))
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp GSTZ1 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Purified
- Immunogène
- GSTZ1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MQAGKPILYSYFRSSCSWRVRIALALKGIDYETVPINLIKDGGQQFSKDF
- Top Product
- Discover our top product GSTZ1 Anticorps primaire
-
-
- Indications d'application
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
GSTZ1 Blocking Peptide, catalog no. 33R-6317, is also available for use as a blocking control in assays to test for specificity of this GSTZ1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GSTZ1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- GSTZ1 (Glutathione Transferase zeta 1 (Maleylacetoacetate Isomerase) (GSTZ1))
- Autre désignation
- GSTZ1 (GSTZ1 Produits)
- Synonymes
- anticorps GSTZ1-1, anticorps MAAI, anticorps MAI, anticorps zgc:113898, anticorps zgc:92869, anticorps PSPTO3554, anticorps DDBDRAFT_0204466, anticorps DDBDRAFT_0231608, anticorps DDB_0204466, anticorps DDB_0231608, anticorps CG9362, anticorps Dmel\CG9362, anticorps gstz1, anticorps glutathione S-transferase zeta 1, anticorps glutathione transferase zeta 1 (maleylacetoacetate isomerase), anticorps maleylacetoacetate isomerase, anticorps Glutathione S transferase Z1, anticorps glutathione S-transferase zeta 1 L homeolog, anticorps GSTZ1, anticorps Gstz1, anticorps gstz1, anticorps maiA, anticorps hmgC, anticorps Patl_1448, anticorps Pnap_2807, anticorps Bind_0562, anticorps Bphyt_0577, anticorps Dtpsy_1678, anticorps Hbal_2638, anticorps mai, anticorps BC1002_0299, anticorps Fbal_2576, anticorps Mesop_3937, anticorps GstZ1, anticorps gstz1.L
- Sujet
- GSTZ1 is a member of the glutathione S-transferase (GSTs) super-family which are important in the detoxification of electrophilic molecules, including carcinogens, mutagens, and several therapeutic drugs, by conjugation with glutathione. This enzyme also plays a significant role in the catabolism of phenylalanine and tyrosine. Thus defects in this enzyme may lead to severe metabolic disorders including alkaptonuria, phenylketonuria and tyrosinaemia.
- Poids moléculaire
- 24 kDa (MW of target protein)
-