LOC653186 anticorps (N-Term)

N° du produit ABIN629757

Détail du produit anti-LOC653186 anticorps

Antigène: LOC653186

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LOC653186 est non-conjugé

Application: Western Blotting (WB)

Specificité: LOC653186 antibody was raised against the N terminal of LOC653186

Purification: Purified

Immunogène: LOC653186 antibody was raised using the N terminal of LOC653186 corresponding to a region with amino acids MKVINAKLDGFYSFPIFLFQFLQATAQEEGIFECADPKLAISAIWTFRDL

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LOC653186 Blocking Peptide, catalog no. 33R-6172, is also available for use as a blocking control in assays to test for specificity of this LOC653186 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LOC653186 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LOC653186

Antigène: LOC653186

Autre désignation: LOC653186 (LOC653186 Produits)

Sujet: The function of LOC653186 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 10 kDa (MW of target protein)