SIK1 anticorps (N-Term)
-
- Antigène Voir toutes SIK1 Anticorps
- SIK1 (Salt-Inducible Kinase 1 (SIK1))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SIK1 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificité
- SNF1 LK antibody was raised against the N terminal of SNF1 K
- Purification
- Purified
- Immunogène
- SNF1 LK antibody was raised using the N terminal of SNF1 K corresponding to a region with amino acids MVIMSEFSADPAGQGQGQQKPLRVGFYDIERTLGKGNFAVVKLARHRVTK
- Top Product
- Discover our top product SIK1 Anticorps primaire
-
anti-Salt-Inducible Kinase 1 (SIK1) (AA 567-597), (C-Term) antibody
SIK1 Reactivité: Humain, Souris WB, IHC (p) Hôte: Lapin Polyclonal RB3576 unconjugated
anti-Salt-Inducible Kinase 1 (SIK1) (AA 1-783) antibodySIK1 Reactivité: Humain WB, IF Hôte: Lapin Polyclonal unconjugated
anti-Salt-Inducible Kinase 1 (SIK1) (AA 1-100) antibodySIK1 Reactivité: Humain ELISA, IF, IHC (p) Hôte: Souris Monoclonal 2C12 unconjugated
anti-Salt-Inducible Kinase 1 (SIK1) (AA 492-750) antibodySIK1 Reactivité: Humain ELISA, IHC, IF Hôte: Lapin Polyclonal unconjugated
anti-Salt-Inducible Kinase 1 (SIK1) (AA 1-783) antibodySIK1 Reactivité: Humain WB, IF Hôte: Souris Polyclonal unconjugated
anti-Salt-Inducible Kinase 1 (SIK1) (N-Term) antibodySIK1 Reactivité: Humain, Cheval, Boeuf (Vache), Xenopus laevis WB, IHC, IHC (p) Hôte: Lapin Polyclonal unconjugated
anti-Salt-Inducible Kinase 1 (SIK1) (AA 1-101) antibodySIK1 Reactivité: Humain ELISA, IHC, IHC (p) Hôte: Souris Monoclonal 2C12 unconjugated
anti-Salt-Inducible Kinase 1 (SIK1) (N-Term) antibodySIK1 Reactivité: Humain, Souris, Rat, Cheval, Chien, Cobaye, Boeuf (Vache), Porc, Lapin WB, IHC Hôte: Lapin Polyclonal unconjugated
anti-Salt-Inducible Kinase 1 (SIK1) (Tyr86) antibodySIK1 Reactivité: Humain, Rat WB, ELISA Hôte: Lapin Polyclonal unconjugated
anti-Salt-Inducible Kinase 1 (SIK1) (AA 51-150) antibodySIK1 Reactivité: Humain, Souris WB, ELISA, FACS Hôte: Lapin Polyclonal unconjugated
-
- Indications d'application
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SNF1LK Blocking Peptide, catalog no. 33R-6587, is also available for use as a blocking control in assays to test for specificity of this SNF1LK antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SNF0 K antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SIK1 (Salt-Inducible Kinase 1 (SIK1))
- Autre désignation
- SNF1LK (SIK1 Produits)
- Synonymes
- anticorps Msk, anticorps Sik, anticorps Snf1lk, anticorps SIK2, anticorps SNF1LK, anticorps MSK, anticorps SIK, anticorps salt-inducible kinase 1, anticorps salt inducible kinase 1, anticorps SIK1, anticorps Sik1
- Sujet
- SNF1LK play a transient role during the earliest stages of myocardial cell differentiation and/or primitive chamber formation and may also be important for the earliest stages of skeletal muscle growth and/or differentiation. It also plays a potential role in G2/M cell cycle regulation. It inhibits CREB activity by phosphorylating and repressing the CREB-specific coactivators, CRTC1-3.
- Poids moléculaire
- 85 kDa (MW of target protein)
- Pathways
- Regulation of Muscle Cell Differentiation, Skeletal Muscle Fiber Development, Regulation of Carbohydrate Metabolic Process
-
