SMPX anticorps (Middle Region)

N° du produit ABIN629759

Détail du produit anti-SMPX anticorps

Antigène: SMPX (Small Muscle Protein, X-Linked (SMPX))

Épitope: Middle Region

Reactivité: Humain, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SMPX est non-conjugé

Application: Western Blotting (WB)

Specificité: SMPX antibody was raised against the middle region of SMPX

Purification: Purified

Immunogène: SMPX antibody was raised using the middle region of SMPX corresponding to a region with amino acids TPEVEEGVPPTSDEEKKPIPGAKKLPGPAVNLSEIQNIKSELKYVPKAEQ

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SMPX Blocking Peptide, catalog no. 33R-9221, is also available for use as a blocking control in assays to test for specificity of this SMPX antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SMPX antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SMPX

Antigène: SMPX (Small Muscle Protein, X-Linked (SMPX))

Autre désignation: SMPX (SMPX Produits)

Synonymes: anticorps DFNX4, anticorps 1010001C09Rik, anticorps Csl, anticorps small muscle protein, X-linked, anticorps SMPX, anticorps Smpx

Sujet: SMPX plays a role in the regulatory network through which muscle cells coordinate their structural and functional states during growth, adaptation, and repair.

Poids moléculaire: 9 kDa (MW of target protein)