DECR2 anticorps (N-Term)

N° du produit ABIN629763

Détail du produit anti-DECR2 anticorps

Antigène: DECR2 (2,4-Dienoyl CoA Reductase 2, Peroxisomal (DECR2))

Épitope: N-Term

Reactivité: Humain, Souris, Rat, Chien, Poisson zèbre (Danio rerio)

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DECR2 est non-conjugé

Application: Western Blotting (WB)

Specificité: DECR2 antibody was raised against the N terminal of DECR2

Purification: Purified

Immunogène: DECR2 antibody was raised using the N terminal of DECR2 corresponding to a region with amino acids MAQPPPDVEGDDCLPAYRHLFCPDLLRDKVAFITGGGSGIGFRIAEIFMR

Information d'application

Indications d'application: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DECR2 Blocking Peptide, catalog no. 33R-5726, is also available for use as a blocking control in assays to test for specificity of this DECR2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DECR2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DECR2

Antigène: DECR2 (2,4-Dienoyl CoA Reductase 2, Peroxisomal (DECR2))

Autre désignation: DECR2 (DECR2 Produits)

Synonymes: anticorps PDCR, anticorps SDR17C1, anticorps zC153C20.5, anticorps zgc:85626, anticorps Dcrakl, anticorps putativeperoxisomal24-dienoyl-CoAreductase, anticorps 2,4-dienoyl-CoA reductase 2, anticorps 2,4-dienoyl CoA reductase 2, peroxisomal, anticorps 2,4-dienoyl-CoA reductase 2 L homeolog, anticorps 2-4-dienoyl-Coenzyme A reductase 2, peroxisomal, anticorps DECR2, anticorps decr2, anticorps decr2.L, anticorps Decr2

Sujet: DECR2 is auxiliary enzyme of beta-oxidation. It participates in the degradation of unsaturated fatty enoyl-CoA esters having double bonds in both even- and odd-numbered positions in peroxisome. It catalyzes the NADP-dependent reduction of 2,4-dienoyl-CoA to yield trans-3-enoyl-CoA and has activity towards short and medium chain 2,4-dienoyl-CoAs, but also towards 2,4,7,10,13,16,19-docosaheptaenoyl-CoA, suggesting that it does not constitute a rate limiting step in the peroxisomal degradation of docosahexaenoic acid.

Poids moléculaire: 32 kDa (MW of target protein)