ALT anticorps

N° du produit ABIN629766

Détail du produit anti-ALT anticorps

Antigène: ALT (Alanine Aminotransferase (ALT))

Reactivité: Humain, Rat, Souris, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ALT est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Purified

Immunogène: GPT antibody was raised using a synthetic peptide corresponding to a region with amino acids RRVEYAVRGPIVQRALELEQELRQGVKKPFTEVIRANIGDAQAMGQRPIT

Information d'application

Indications d'application: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GPT Blocking Peptide, catalog no. 33R-8167, is also available for use as a blocking control in assays to test for specificity of this GPT antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GPT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ALT

Antigène: ALT (Alanine Aminotransferase (ALT))

Autre désignation: GPT (ALT Produits)

Sujet: GPT participates in cellular nitrogen metabolism and also in liver gluconeogenesis starting with precursors transported from skeletal muscles.

Poids moléculaire: 55 kDa (MW of target protein)