SGPP2 anticorps (C-Term)

N° du produit ABIN629768

Détail du produit anti-SGPP2 anticorps

Antigène: SGPP2 (Sphingosine-1-Phosphate Phosphatase 2 (SGPP2))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SGPP2 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: SGPP2 antibody was raised against the C terminal of SGPP2

Purification: Purified

Immunogène: SGPP2 antibody was raised using the C terminal of SGPP2 corresponding to a region with amino acids SKPAESLPVIQNIPPLTTYMLVLGLTKFAVGIVLILLVRQLVQNLSLQVL

Information d'application

Indications d'application: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SGPP2 Blocking Peptide, catalog no. 33R-8562, is also available for use as a blocking control in assays to test for specificity of this SGPP2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SGPP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SGPP2

Antigène: SGPP2 (Sphingosine-1-Phosphate Phosphatase 2 (SGPP2))

Autre désignation: SGPP2 (SGPP2 Produits)

Synonymes: anticorps SPP2, anticorps RGD1565739, anticorps SPPase2, anticorps Spp2, anticorps sphingosine-1-phosphate phosphatase 2, anticorps sphingosine-1-phosphate phosphotase 2, anticorps SGPP2, anticorps Sgpp2

Sujet: In vitro, SGPP2 has high phosphohydrolase activity against dihydrosphingosine-1-phosphate and sphingosine-1-phosphate (S1P).

Poids moléculaire: 37 kDa (MW of target protein)