ACTR2 anticorps

N° du produit ABIN629770

Détail du produit anti-ACTR2 anticorps

Antigène: ACTR2 (Actin-Related Protein 2 (ACTR2))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ACTR2 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Purified

Immunogène: ACTR2 antibody was raised using a synthetic peptide corresponding to a region with amino acids NGIVRNWDDMKHLWDYTFGPEKLNIDTRNCKILLTEPPMNPTKNREKIVE

Information d'application

Indications d'application: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ACTR2 Blocking Peptide, catalog no. 33R-6704, is also available for use as a blocking control in assays to test for specificity of this ACTR2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACTR2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ACTR2

Antigène: ACTR2 (Actin-Related Protein 2 (ACTR2))

Autre désignation: ACTR2 (ACTR2 Produits)

Synonymes: anticorps ARP2, anticorps 4921510D23Rik, anticorps AA409782, anticorps Arp2, anticorps D6Ertd746e, anticorps actr2, anticorps hm:zeh1257, anticorps zgc:63719, anticorps actr2-B, anticorps arp2-B, anticorps arp2, anticorps ACTR2, anticorps DKFZp459N093, anticorps ACTIN RELATED PROTEIN 2, anticorps ATARP2, anticorps WRM, anticorps WURM, anticorps actin related protein 2, anticorps actr2-A, anticorps arp2-A, anticorps zgc:110550, anticorps ARP2 actin related protein 2 homolog, anticorps ARP2 actin-related protein 2, anticorps ARP2 actin related protein 2a homolog, anticorps ARP2 actin-related protein 2 homolog L homeolog, anticorps ARP2 actin-related protein 2 homolog, anticorps actin-related protein Arp2, anticorps actin related protein 2, anticorps ARP2 actin-related protein 2 homolog S homeolog, anticorps ARP2 actin related protein 2b homolog, anticorps ARP2/3 actin-organizing complex subunit Arp2, anticorps ACTR2, anticorps Actr2, anticorps actr2a, anticorps actr2.L, anticorps actr2, anticorps arp2, anticorps ARP2, anticorps actr2.S, anticorps actr2b

Sujet: ACTR2 is known to be a major constituent of the ARP2/3 complex. This complex is located at the cell surface and is essential to cell shape and motility through lamellipodial actin assembly and protrusion.

Poids moléculaire: 45 kDa (MW of target protein)

Pathways: Signalisation RTK, Regulation of Actin Filament Polymerization