C1orf33 anticorps
-
- Antigène Voir toutes C1orf33 (MRTO4) Anticorps
- C1orf33 (MRTO4) (mRNA Turnover 4 Homolog (MRTO4))
-
Reactivité
- Humain, Rat, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp C1orf33 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Purified
- Immunogène
- MRTO4 antibody was raised using a synthetic peptide corresponding to a region with amino acids SKLKDIRNAWKHSRMFFGKNKVMMVALGRSPSDEYKDNLHQVSKRLRGEV
- Top Product
- Discover our top product MRTO4 Anticorps primaire
-
-
- Indications d'application
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
MRTO4 Blocking Peptide, catalog no. 33R-8557, is also available for use as a blocking control in assays to test for specificity of this MRTO4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MRTO4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- C1orf33 (MRTO4) (mRNA Turnover 4 Homolog (MRTO4))
- Autre désignation
- MRTO4 (MRTO4 Produits)
- Synonymes
- anticorps mrt4, anticorps wu:fb71a02, anticorps zgc:110388, anticorps C1orf33, anticorps MRT4, anticorps dJ657E11.4, anticorps RGD1311709, anticorps 2610012O22Rik, anticorps Mg684, anticorps Mrt4, anticorps MRT4 homolog, ribosome maturation factor L homeolog, anticorps MRT4 homolog, ribosome maturation factor, anticorps mRNA turnover 4, ribosome maturation factor, anticorps mrto4.L, anticorps mrto4, anticorps MRTO4, anticorps Mrto4
- Sujet
- MRTO4 is a protein sharing a low level of sequence similarity with ribosomal protein P0. While the precise function of the protein is currently unknown, it appears to be involved in mRNA turnover and ribosome assembly.
- Poids moléculaire
- 27 kDa (MW of target protein)
-