FNTA anticorps (C-Term)
-
- Antigène Voir toutes FNTA Anticorps
- FNTA (Farnesyltransferase, CAAX Box, alpha (FNTA))
-
Épitope
- C-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp FNTA est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- FNTA antibody was raised against the C terminal of FNTA
- Purification
- Purified
- Immunogène
- FNTA antibody was raised using the C terminal of FNTA corresponding to a region with amino acids DNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHSTENDSPTNV
- Top Product
- Discover our top product FNTA Anticorps primaire
-
-
- Indications d'application
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
FNTA Blocking Peptide, catalog no. 33R-2083, is also available for use as a blocking control in assays to test for specificity of this FNTA antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FNTA antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- FNTA (Farnesyltransferase, CAAX Box, alpha (FNTA))
- Autre désignation
- FNTA (FNTA Produits)
- Synonymes
- anticorps ATFTA, anticorps FARNESYLTRANSFERASE A, anticorps FARNESYLTRANSFERASE SUBUNIT A, anticorps PFT/PGGT-IALPHA, anticorps PLP, anticorps PLURIPETALA, anticorps farnesyltransferase A, anticorps FPTA, anticorps PGGT1A, anticorps PTAR2, anticorps PFAS, anticorps FTA, anticorps farnesyltransferase A, anticorps farnesyltransferase, CAAX box, alpha, anticorps FTA, anticorps FNTA, anticorps Fnta
- Sujet
- Prenyltransferases attach either a farnesyl group or a geranylgeranyl group in thioether linkage to the cysteine residue of protein's with a C-terminal CAAX box. CAAX geranylgeranyltransferase and CAAX farnesyltransferase are heterodimers that share the same alpha subunit but have different beta subunits. FNTA is the alpha subunit of these transferases.
- Poids moléculaire
- 36 kDa (MW of target protein)
- Pathways
- Response to Water Deprivation, Regulation of G-Protein Coupled Receptor Protein Signaling
-