SEPHS1 anticorps (C-Term)

N° du produit ABIN629776

Détail du produit anti-SEPHS1 anticorps

Antigène: SEPHS1 (Selenophosphate Synthetase 1 (SEPHS1))

Épitope: C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SEPHS1 est non-conjugé

Application: Western Blotting (WB)

Specificité: SEPHS1 antibody was raised against the C terminal of SEPHS1

Purification: Purified

Immunogène: SEPHS1 antibody was raised using the C terminal of SEPHS1 corresponding to a region with amino acids PKYGEGHQAWIIGIVEKGNRTARIIDKPRIIEVAPQVATQNVNPTPGATS

Information d'application

Indications d'application: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SEPHS1 Blocking Peptide, catalog no. 33R-7181, is also available for use as a blocking control in assays to test for specificity of this SEPHS1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SEPHS1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SEPHS1

Antigène: SEPHS1 (Selenophosphate Synthetase 1 (SEPHS1))

Autre désignation: SEPHS1 (SEPHS1 Produits)

Synonymes: anticorps Sps1, anticorps SEPHS1, anticorps SEPHS1_tv1, anticorps 1110046B24Rik, anticorps AA589574, anticorps AI505014, anticorps AW111620, anticorps SELD, anticorps SPS, anticorps SPS1, anticorps wu:fc49b09, anticorps zgc:55304, anticorps selenophosphate synthetase 1, anticorps selenophosphate synthetase 1 L homeolog, anticorps sucrose phosphate synthase 1, anticorps sucrose-phosphate synthase, anticorps SEPHS1, anticorps sephs1, anticorps Sps1, anticorps Sephs1, anticorps sephs1.L, anticorps sps1, anticorps sps

Sujet: SEPHS1 is an enzyme that synthesizes selenophosphate from selenide and ATP. Selenophosphate is the selenium donor used to synthesize selenocysteine, which is co-translationally incorporated into selenoproteins at in-frame UGA codons.

Poids moléculaire: 43 kDa (MW of target protein)