TRMT2B anticorps (Middle Region)
-
- Antigène Voir toutes TRMT2B Anticorps
- TRMT2B (tRNA Methyltransferase 2 Homolog B (TRMT2B))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp TRMT2B est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- CXORF34 antibody was raised against the middle region of Cxorf34
- Purification
- Purified
- Immunogène
- CXORF34 antibody was raised using the middle region of Cxorf34 corresponding to a region with amino acids GAACGLTSLYFQESTMTRCSHQQSPYQLLFGEPYIFEELLSLKIRISPDA
- Top Product
- Discover our top product TRMT2B Anticorps primaire
-
-
- Indications d'application
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CXORF34 Blocking Peptide, catalog no. 33R-3146, is also available for use as a blocking control in assays to test for specificity of this CXORF34 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CXORF34 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- TRMT2B (tRNA Methyltransferase 2 Homolog B (TRMT2B))
- Autre désignation
- CXORF34 (TRMT2B Produits)
- Synonymes
- anticorps CXorf34, anticorps dJ341D10.3, anticorps 4732479N06Rik, anticorps im:7160396, anticorps wu:fc49d02, anticorps zgc:162982, anticorps tRNA methyltransferase 2 homolog B, anticorps TRM2 tRNA methyltransferase 2B, anticorps TRMT2B, anticorps Trmt2b, anticorps trmt2b
- Sujet
- CXorf34 is a putative methyltransferase.
- Poids moléculaire
- 56 kDa (MW of target protein)
-