NAA50 anticorps (C-Term)
-
- Antigène Voir toutes NAA50 Anticorps
- NAA50 (N(alpha)-Acetyltransferase 50, NatE Catalytic Subunit (NAA50))
-
Épitope
- C-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp NAA50 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- NAT13 antibody was raised against the C terminal of NAT13
- Purification
- Purified
- Immunogène
- NAT13 antibody was raised using the C terminal of NAT13 corresponding to a region with amino acids AIDFYRKFGFEIIETKKNYYKRIEPADAHVLQKNLKVPSGQNADVQKTDN
- Top Product
- Discover our top product NAA50 Anticorps primaire
-
-
- Indications d'application
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
NAT13 Blocking Peptide, catalog no. 33R-1262, is also available for use as a blocking control in assays to test for specificity of this NAT13 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NAT13 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- NAA50 (N(alpha)-Acetyltransferase 50, NatE Catalytic Subunit (NAA50))
- Autre désignation
- NAT13 (NAA50 Produits)
- Synonymes
- anticorps MAK3, anticorps NAT13, anticorps NAT5, anticorps SAN, anticorps hNAT5, anticorps hSAN, anticorps 2600005K24Rik, anticorps 2810441M03Rik, anticorps AW112078, anticorps Mak3, anticorps Mak3p, anticorps Nat13, anticorps Nat5, anticorps San, anticorps DKFZp469M1032, anticorps san, anticorps mak3, anticorps nat5, anticorps nat13, anticorps MGC80671, anticorps N(alpha)-acetyltransferase 50, NatE catalytic subunit, anticorps N(alpha)-acetyltransferase 50, NatE catalytic subunit L homeolog, anticorps NAA50, anticorps Naa50, anticorps naa50.L
- Sujet
- NAT13 is a probable catalytic component of the ARD1A-NARG1 complex which displays alpha (N-terminal) acetyltransferase activity.
- Poids moléculaire
- 19 kDa (MW of target protein)
-