UXT anticorps (N-Term)

N° du produit ABIN629784

Détail du produit anti-UXT anticorps

Antigène: UXT (Ubiquitously-Expressed, Prefoldin-Like Chaperone (UXT))

Épitope: N-Term

Reactivité: Humain, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp UXT est non-conjugé

Application: Western Blotting (WB)

Specificité: UXT antibody was raised against the N terminal of UXT

Purification: Purified

Immunogène: UXT antibody was raised using the N terminal of UXT corresponding to a region with amino acids MATPPKRRAVEATGEKVLRYETFISDVLQRDLRKVLDHRDKVYEQLAKYL

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

UXT Blocking Peptide, catalog no. 33R-5784, is also available for use as a blocking control in assays to test for specificity of this UXT antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UXT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur UXT

Antigène: UXT (Ubiquitously-Expressed, Prefoldin-Like Chaperone (UXT))

Autre désignation: UXT (UXT Produits)

Synonymes: anticorps zgc:101894, anticorps 0910002B17Rik, anticorps ART-27, anticorps STAP1, anticorps ubiquitously-expressed, prefoldin-like chaperone, anticorps ubiquitously expressed prefoldin like chaperone, anticorps ubiquitously-expressed transcript, anticorps ubiquitously expressed transcript, anticorps uxt, anticorps UXT, anticorps Uxt

Sujet: UXT is a novel protein which is highly conserved in mouse. It interacts with the N-terminus of the androgen receptor and plays a role in facilitating receptor-induced transcriptional activation. It is also likely to be involved in tumorigenesis as it is abundantly expressed in tumor tissues.

Poids moléculaire: 19 kDa (MW of target protein)

Pathways: Unfolded Protein Response