MKRN1 anticorps (N-Term)
-
- Antigène Voir toutes MKRN1 Anticorps
- MKRN1 (Makorin Ring Finger Protein 1 (MKRN1))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Chien, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp MKRN1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- MKRN1 antibody was raised against the N terminal of MKRN1
- Purification
- Purified
- Immunogène
- MKRN1 antibody was raised using the N terminal of MKRN1 corresponding to a region with amino acids GDRCRYEHSKPLKQEEATATELTTKSSLAASSSLSSIVGPLVEMNTGEAE
- Top Product
- Discover our top product MKRN1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
MKRN1 Blocking Peptide, catalog no. 33R-3207, is also available for use as a blocking control in assays to test for specificity of this MKRN1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MKRN1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- MKRN1 (Makorin Ring Finger Protein 1 (MKRN1))
- Autre désignation
- MKRN1 (MKRN1 Produits)
- Synonymes
- anticorps MKRN1, anticorps MGC84269, anticorps mkrn1, anticorps Makorin-1, anticorps RNF61, anticorps RFP, anticorps makorin ring finger protein 1, anticorps E3 ubiquitin-protein ligase makorin-1, anticorps makorin ring finger protein 1 S homeolog, anticorps makorin, ring finger protein, 1, anticorps MKRN1, anticorps LOC100393879, anticorps mkrn1.S, anticorps Mkrn1
- Sujet
- The Makorin ring finger protein-1 gene (MKRN1) is a highly transcribed, intron-containing source for a family of intronless mammalian genes encoding a novel class of zinc finger proteins. Phylogenetic analyses indicate that the MKRN1 gene is the ancestral founder of this gene family.
- Poids moléculaire
- 16 kDa (MW of target protein)
- Pathways
- Chromatin Binding
-