SLC38A4 anticorps (Middle Region)
-
- Antigène Voir toutes SLC38A4 Anticorps
- SLC38A4 (Solute Carrier Family 38 Member 4 (SLC38A4))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat, Chien, Poisson zèbre (Danio rerio), C. elegans, Drosophila melanogaster
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SLC38A4 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificité
- SLC38 A4 antibody was raised against the middle region of SLC38 4
- Purification
- Purified
- Immunogène
- SLC38 A4 antibody was raised using the middle region of SLC38 4 corresponding to a region with amino acids LAALFGYLTFYGEVEDELLHAYSKVYTLDIPLLMVRLAVLVAVTLTVPIV
- Top Product
- Discover our top product SLC38A4 Anticorps primaire
-
-
- Indications d'application
-
WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SLC38A4 Blocking Peptide, catalog no. 33R-4755, is also available for use as a blocking control in assays to test for specificity of this SLC38A4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SLC38A4 (Solute Carrier Family 38 Member 4 (SLC38A4))
- Autre désignation
- SLC38A4 (SLC38A4 Produits)
- Synonymes
- anticorps wu:fd51c05, anticorps zgc:103694, anticorps zgc:113830, anticorps SLC38A4, anticorps ATA3, anticorps SNAT4, anticorps NAT3, anticorps PAAT, anticorps 1110012E16Rik, anticorps 1700012A18Rik, anticorps Ata3, anticorps mATA3, anticorps mNAT3, anticorps solute carrier family 38, member 4, anticorps solute carrier family 38 member 4, anticorps slc38a4, anticorps SLC38A4, anticorps Slc38a4
- Sujet
- SLC38A4 is found predominantly in liver and transports both cationic and neutral amino acids. The transport of cationic amino acids by SLC38A4 is Na(+) and pH independent, while the transport of neutral amino acids is Na(+) and pH dependent.
- Poids moléculaire
- 17 kDa (MW of target protein)
-