GIPC2 anticorps (N-Term)

N° du produit ABIN629789

Détail du produit anti-GIPC2 anticorps

Antigène: GIPC2 (GIPC PDZ Domain Containing Family, Member 2 (GIPC2))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GIPC2 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: GIPC2 antibody was raised against the N terminal of GIPC2

Purification: Purified

Immunogène: GIPC2 antibody was raised using the N terminal of GIPC2 corresponding to a region with amino acids MPLKLRGKKKAKSKETAGLVEGEPTGAGGGSLSASRAPARRLVFHAQLAH

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GIPC2 Blocking Peptide, catalog no. 33R-6291, is also available for use as a blocking control in assays to test for specificity of this GIPC2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GIPC2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GIPC2

Antigène: GIPC2 (GIPC PDZ Domain Containing Family, Member 2 (GIPC2))

Autre désignation: GIPC2 (GIPC2 Produits)

Synonymes: anticorps SEMCAP-2, anticorps SEMCAP2, anticorps 2200002N01Rik, anticorps AU021850, anticorps Semcap2, anticorps gipc1, anticorps rgs19ip1, anticorps zgc:56157, anticorps zgc:77689, anticorps gipc, anticorps MGC85196, anticorps GIPC2, anticorps GIPC PDZ domain containing family member 2, anticorps GIPC PDZ domain containing family, member 2, anticorps GIPC PDZ domain containing family member 2 S homeolog, anticorps GIPC2, anticorps Gipc2, anticorps gipc2, anticorps gipc2.S

Sujet: GIPC1/GIPC, GIPC2, and GIPC3 are a family of central PDZ-domain proteins. GIPC2 might play important roles in human gastric cancer through modulation of growth factor signaling or cell adhesion. GIPC1, GIPC2 and GIPC3 might play key roles in carcinogenesis and embryogenesis through modulation of growth factor signaling and cell adhesion.

Poids moléculaire: 35 kDa (MW of target protein)