CTP Synthase anticorps (C-Term)

N° du produit ABIN629790

Détail du produit anti-CTP Synthase anticorps

Antigène: CTP Synthase (CTPS)

Épitope: C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CTP Synthase est non-conjugé

Application: Western Blotting (WB)

Specificité: Ctp Synthase antibody was raised against the C terminal of CTPS

Purification: Purified

Immunogène: Ctp Synthase antibody was raised using the C terminal of CTPS corresponding to a region with amino acids FGLLLASVGRLSHYLQKGCRLSPRDTYSDRSGSSSPDSEITELKFPSINH

Information d'application

Indications d'application: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Ctp Synthase Blocking Peptide, catalog no. 33R-2906, is also available for use as a blocking control in assays to test for specificity of this Ctp Synthase antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CTPS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CTP Synthase

Antigène: CTP Synthase (CTPS)

Autre désignation: Ctp Synthase (CTPS Produits)

Synonymes: anticorps Ctps, anticorps CTPS, anticorps Ctps1, anticorps ctps, anticorps ctps-b, anticorps ctps1-b, anticorps DDBDRAFT_0206047, anticorps DDBDRAFT_0230162, anticorps DDB_0206047, anticorps DDB_0230162, anticorps cb1040, anticorps ctps1, anticorps ctpsa, anticorps wu:fb49e03, anticorps wu:fe17b03, anticorps ACYPI010091, anticorps An03g01310, anticorps CTP synthase, anticorps CTP synthase 1, anticorps cytidine 5'-triphosphate synthase, anticorps CTP synthase 1 L homeolog, anticorps CTP synthase 1a, anticorps CTP synthase PyrG, anticorps CTP synthetase, anticorps Ctps, anticorps CTPS1, anticorps Ctps1, anticorps ctps1.L, anticorps ctps, anticorps ctps1a, anticorps CNC00220, anticorps ANI_1_154034, anticorps ctps1, anticorps pyrG, anticorps HMPREF0659_RS10035, anticorps Flexsi_0977

Sujet: The catalytic conversion of UTP to CTP is accomplished by the enzyme cytidine-5-prime-triphosphate synthetase. The enzyme is important in the biosynthesis of phospholipids and nucleic acids, and plays a key role in cell growth, development, and tumorigenesis.

Poids moléculaire: 67 kDa (MW of target protein)

Pathways: Proton Transport, Ribonucleoside Biosynthetic Process