FBP1 anticorps (N-Term)

N° du produit ABIN629795

Détail du produit anti-FBP1 anticorps

Antigène: FBP1 (Fructose-1,6-Bisphosphatase 1 (FBP1))

Épitope: N-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FBP1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: FBP1 antibody was raised against the N terminal of FBP1

Purification: Purified

Immunogène: FBP1 antibody was raised using the N terminal of FBP1 corresponding to a region with amino acids YVVCFDPLDGSSNIDCLVSVGTIFGIYRKKSTDEPSEKDALQPGRNLVAA

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FBP1 Blocking Peptide, catalog no. 33R-10289, is also available for use as a blocking control in assays to test for specificity of this FBP1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FBP1

Antigène: FBP1 (Fructose-1,6-Bisphosphatase 1 (FBP1))

Autre désignation: FBP1 (FBP1 Produits)

Synonymes: anticorps FBP, anticorps Fbp-2, anticorps Fbp2, anticorps Fbp3, anticorps FBP1, anticorps fbp2, anticorps Fdp, anticorps CG10611, anticorps CG31692, anticorps Dmel\\CG31692, anticorps FbPase, anticorps fbp1, anticorps cb598, anticorps fb57b01, anticorps zgc:64127, anticorps id:ibd1091, anticorps wu:fb17g10, anticorps wu:fb57b01, anticorps fdp, anticorps xcc-b100_0105, anticorps fbp1l, anticorps fk92h02, anticorps wu:fk92h02, anticorps zgc:64096, anticorps fbp, anticorps fbp1.S, anticorps fructose-bisphosphatase 1, anticorps fructose bisphosphatase 1, anticorps Fructose-1,6-bisphosphatase, anticorps fructose-1,6-bisphosphatase, anticorps fructose-1,6-bisphosphatase 1, anticorps fructose-bisphosphatase class I, anticorps fructose-1,6-bisphosphatase 1b, anticorps fbp, anticorps fructose-1,6-bisphosphatase 1a, anticorps fructose-bisphosphatase 1 L homeolog, anticorps FBP1, anticorps Fbp1, anticorps fbp1, anticorps LOC100136618, anticorps RR_RS07410, anticorps fbp, anticorps fbp1b, anticorps fbp1a, anticorps fbp1.L

Sujet: Fructose-1,6-bisphosphatase 1, a gluconeogenesis regulatory enzyme, catalyzes the hydrolysis of fructose 1,6-bisphosphate to fructose 6-phosphate and inorganic phosphate. Fructose-1,6-diphosphatase deficiency is associated with hypoglycemia and metabolic acidosis.Fructose-1,6-bisphosphatase 1, a gluconeogenesis regulatory enzyme, catalyzes the hydrolysis of fructose 1,6-bisphosphate to fructose 6-phosphate and inorganic phosphate. Fructose-1,6-diphosphatase deficiency is associated with hypoglycemia and metabolic acidosis.

Poids moléculaire: 37 kDa (MW of target protein)

Pathways: Cellular Glucan Metabolic Process, Regulation of Carbohydrate Metabolic Process, Dicarboxylic Acid Transport