PSD3 anticorps (Middle Region)
-
- Antigène Voir toutes PSD3 Anticorps
- PSD3 (Pleckstrin and Sec7 Domain Containing 3 (PSD3))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PSD3 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificité
- PSD3 antibody was raised against the middle region of PSD3
- Purification
- Purified
- Immunogène
- PSD3 antibody was raised using the middle region of PSD3 corresponding to a region with amino acids SDVAKHLGKNNEFSKLVAEEYLKFFDFTGMTLDQSLRYFFKAFSLVGETQ
- Top Product
- Discover our top product PSD3 Anticorps primaire
-
-
- Indications d'application
-
WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PSD3 Blocking Peptide, catalog no. 33R-8378, is also available for use as a blocking control in assays to test for specificity of this PSD3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSD3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PSD3 (Pleckstrin and Sec7 Domain Containing 3 (PSD3))
- Autre désignation
- PSD3 (PSD3 Produits)
- Sujet
- PSD3 is a guanine nucleotide exchange factor for ARF6.
- Poids moléculaire
- 56 kDa (MW of target protein)
-