PSD3 anticorps (Middle Region)

N° du produit ABIN629799

Détail du produit anti-PSD3 anticorps

Antigène: PSD3 (Pleckstrin and Sec7 Domain Containing 3 (PSD3))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PSD3 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: PSD3 antibody was raised against the middle region of PSD3

Purification: Purified

Immunogène: PSD3 antibody was raised using the middle region of PSD3 corresponding to a region with amino acids SDVAKHLGKNNEFSKLVAEEYLKFFDFTGMTLDQSLRYFFKAFSLVGETQ

Information d'application

Indications d'application: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PSD3 Blocking Peptide, catalog no. 33R-8378, is also available for use as a blocking control in assays to test for specificity of this PSD3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSD3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PSD3

Antigène: PSD3 (Pleckstrin and Sec7 Domain Containing 3 (PSD3))

Autre désignation: PSD3 (PSD3 Produits)

Synonymes: anticorps PSD3, anticorps EFA6R, anticorps HCA67, anticorps 4931420C21Rik, anticorps AI661273, anticorps BC003498, anticorps D430018P08, anticorps EFA6D, anticorps RGD1559968, anticorps pleckstrin and Sec7 domain containing 3, anticorps PH and SEC7 domain-containing protein 3, anticorps PSD3, anticorps LOC100476735, anticorps Psd3

Sujet: PSD3 is a guanine nucleotide exchange factor for ARF6.

Poids moléculaire: 56 kDa (MW of target protein)