TARS anticorps (N-Term)

N° du produit ABIN629800

Détail du produit anti-TARS anticorps

Antigène: TARS (threonyl-tRNA Synthetase (TARS))

Épitope: N-Term

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TARS est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: TARS antibody was raised against the N terminal of TARS

Purification: Purified

Immunogène: TARS antibody was raised using the N terminal of TARS corresponding to a region with amino acids PEYIYTRLEMYNILKAEHDSILAEKAEKDSKPIKVTLPDGKQVDAESWKT

Information d'application

Indications d'application: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TARS Blocking Peptide, catalog no. 33R-7067, is also available for use as a blocking control in assays to test for specificity of this TARS antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TARS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TARS

Antigène: TARS (threonyl-tRNA Synthetase (TARS))

Autre désignation: TARS (TARS Produits)

Synonymes: anticorps ThrRS, anticorps wu:fb07c05, anticorps wu:fb39c12, anticorps zgc:92586, anticorps 42/3, anticorps CG5353, anticorps Dmel\\CG5353, anticorps P539, anticorps TRS, anticorps l(2)k04203, anticorps threonyl-tRNA synthetase, anticorps tarsl2, anticorps TARS, anticorps D15Wsu59e, anticorps threonyl-tRNA synthetase L homeolog, anticorps threonyl-tRNA synthetase, anticorps Threonyl-tRNA synthetase, anticorps threonyl-tRNA synthetase 2, mitochondrial (putative), anticorps tars.L, anticorps tars, anticorps TARS, anticorps ThrRS, anticorps thrS, anticorps tars2, anticorps Tars

Sujet: Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. Threonyl-tRNA synthetase belongs to the class-II aminoacyl-tRNA synthetase family.

Poids moléculaire: 78 kDa (MW of target protein)