PPFIBP1 anticorps
-
- Antigène Voir toutes PPFIBP1 Anticorps
- PPFIBP1 (PTPRF Interacting Protein, Binding Protein 1 (Liprin beta 1) (PPFIBP1))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PPFIBP1 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Purified
- Immunogène
- PPFIBP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PFMGSLRALHLVEDLRGLLEMMETDEKEGLRCQIPDSTAETLVEWLQSQM
- Top Product
- Discover our top product PPFIBP1 Anticorps primaire
-
-
- Indications d'application
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PPFIBP1 Blocking Peptide, catalog no. 33R-7081, is also available for use as a blocking control in assays to test for specificity of this PPFIBP1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPFIBP1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PPFIBP1 (PTPRF Interacting Protein, Binding Protein 1 (Liprin beta 1) (PPFIBP1))
- Autre désignation
- PPFIBP1 (PPFIBP1 Produits)
- Synonymes
- anticorps liprin-beta-1, anticorps L2, anticorps SGT2, anticorps hSGT2, anticorps hSgt2p, anticorps 4632409B19Rik, anticorps AW214454, anticorps AW261454, anticorps PPFIA binding protein 1, anticorps PTPRF interacting protein, binding protein 1 (liprin beta 1), anticorps PTPRF interacting protein, binding protein 1 (liprin beta 1) S homeolog, anticorps Ppfibp1, anticorps ppfibp1, anticorps ppfibp1.S, anticorps PPFIBP1
- Sujet
- PPFIBP1 is a member of the LAR protein-tyrosine phosphatase-interacting protein (liprin) family. Liprins interact with members of LAR family of transmembrane protein tyrosine phosphatases, which are known to be important for axon guidance and mammary gland development. It has been proposed that liprins are multivalent proteins that form complex structures and act as scaffolds for the recruitment and anchoring of LAR family of tyrosine phosphatases. This protein was found to interact with S100A4, a calcium-binding protein related to tumor invasiveness and metastasis.
- Poids moléculaire
- 19 kDa (MW of target protein)
-