PKLR anticorps (N-Term)
-
- Antigène Voir toutes PKLR Anticorps
- PKLR (Pyruvate Kinase, Liver and RBC (PKLR))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat, Chien, C. elegans
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PKLR est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificité
- PKLR antibody was raised against the N terminal of PKLR
- Purification
- Purified
- Immunogène
- PKLR antibody was raised using the N terminal of PKLR corresponding to a region with amino acids STSIIATIGPASRSVERLKEMIKAGMNIARLNFSHGSHEYHAESIANVRE
- Top Product
- Discover our top product PKLR Anticorps primaire
-
-
- Indications d'application
-
WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PKLR Blocking Peptide, catalog no. 33R-8888, is also available for use as a blocking control in assays to test for specificity of this PKLR antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PKLR antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PKLR (Pyruvate Kinase, Liver and RBC (PKLR))
- Autre désignation
- PKLR (PKLR Produits)
- Sujet
- PKLR is a pyruvate kinase that catalyzes the production of phohsphoenolpyruvate from pyruvate and ATP. Defects in this enzyme, due to gene mutations or genetic variations, are the common cause of chronic hereditary nonspherocytic hemolytic anemia (CNSHA or HNSHA).
- Poids moléculaire
- 58 kDa (MW of target protein)
- Pathways
- Ribonucleoside Biosynthetic Process
-