HBZ anticorps (N-Term)
-
- Antigène Voir toutes HBZ Anticorps
- HBZ (Hemoglobin, zeta (HBZ))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp HBZ est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificité
- Hemoglobin Zeta antibody was raised against the N terminal of HBZ
- Purification
- Purified
- Immunogène
- Hemoglobin Zeta antibody was raised using the N terminal of HBZ corresponding to a region with amino acids ERLFLSHPQTKTYFPHFDLHPGSAQLRAHGSKVVAAVGDAVKSIDDIGGA
- Top Product
- Discover our top product HBZ Anticorps primaire
-
anti-Hemoglobin, zeta (HBZ) (AA 1-81) antibody
HBZ Reactivité: Humain WB, ELISA, IHC (p) Hôte: Souris Monoclonal 1G10 unconjugated
anti-Hemoglobin, zeta (HBZ) (AA 1-142) antibodyHBZ Reactivité: Humain WB, ELISA Hôte: Souris Monoclonal 3C4-1D5 unconjugated
anti-Hemoglobin, zeta (HBZ) antibodyHBZ Reactivité: Humain WB, ELISA, IHC Hôte: Lapin Polyclonal unconjugated
anti-Hemoglobin, zeta (HBZ) (AA 1-142) antibodyHBZ Reactivité: Humain WB, ELISA, IHC Hôte: Lapin Polyclonal unconjugated
anti-Hemoglobin, zeta (HBZ) (AA 95-123), (C-Term) antibodyHBZ Reactivité: Humain WB Hôte: Lapin Polyclonal RB41010 unconjugated
anti-Hemoglobin, zeta (HBZ) (AA 31-80) antibodyHBZ Reactivité: Humain, Rat, Cheval, Singe WB, IHC, IHC (p) Hôte: Lapin Polyclonal unconjugated
anti-Hemoglobin, zeta (HBZ) (N-Term) antibodyHBZ Reactivité: Humain, Rat, Souris, Cheval, Boeuf (Vache), Chévre, Porc, Lapin WB, IHC Hôte: Lapin Polyclonal unconjugated
-
- Indications d'application
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Hemoglobin Zeta Blocking Peptide, catalog no. 33R-2702, is also available for use as a blocking control in assays to test for specificity of this Hemoglobin Zeta antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HBZ antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- HBZ (Hemoglobin, zeta (HBZ))
- Autre désignation
- Hemoglobin zeta (HBZ Produits)
- Synonymes
- anticorps RGD1307486, anticorps HBZ, anticorps hba-l1, anticorps MGC82702, anticorps RA_M008_JSM295ECF, anticorps hemoglobin, zeta, anticorps hemoglobin subunit zeta, anticorps HBZ, anticorps Hbz, anticorps HBZ1, anticorps hbz
- Sujet
- Zeta-globin is an alpha-like hemoglobin. The zeta-globin polypeptide is synthesized in the yolk sac of the early embryo, while alpha-globin is produced throughout fetal and adult like. The zeta-globin gene is a member of the human alpha-globin gene cluster that includes five functional genes and two pseudogenes.
- Poids moléculaire
- 16 kDa (MW of target protein)
-
