GINS1 anticorps

N° du produit ABIN629812

Détail du produit anti-GINS1 anticorps

Antigène: GINS1 (GINS Complex Subunit 1 (Psf1 Homolog) (GINS1))

Reactivité: Humain, Souris, Chien, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GINS1 est non-conjugé

Application: Western Blotting (WB)

Purification: Purified

Immunogène: GINS1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MFCEKAMELIRELHRAPEGQLPAFNEDGLRQVLEEMKALYEQNQSDVNEA

Information d'application

Indications d'application: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GINS1 Blocking Peptide, catalog no. 33R-5986, is also available for use as a blocking control in assays to test for specificity of this GINS1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GINS1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GINS1

Antigène: GINS1 (GINS Complex Subunit 1 (Psf1 Homolog) (GINS1))

Autre désignation: GINS1 (GINS1 Produits)

Synonymes: anticorps CG9187, anticorps CG9187-PA, anticorps Dmel\CG9187, anticorps psf1, anticorps GINS1, anticorps zgc:101672, anticorps PSF1, anticorps 2810418N01Rik, anticorps Gins4, anticorps mKIAA0186, anticorps RGD1562246, anticorps DNA replication complex GINS protein psf-1, anticorps DNA replication complex GINS protein psf1, anticorps DNA replication complex GINS protein PSF1, anticorps GINS complex subunit 1, anticorps CG9187 gene product from transcript CG9187-RA, anticorps GINS complex subunit 1 (Psf1 homolog), anticorps GINS complex subunit 1 (Psf1 homolog) S homeolog, anticorps DNA replication protein, anticorps NCU02631, anticorps AOR_1_746184, anticorps CC1G_12309, anticorps CTRG_04863, anticorps PAAG_03089, anticorps MCYG_01460, anticorps PITG_00071, anticorps VDBG_04832, anticorps MGYG_04613, anticorps TERG_08027, anticorps gins1, anticorps Psf1, anticorps GINS1, anticorps gins1.S, anticorps Gins1, anticorps PSF1

Sujet: The GINS complex plays an essential role in the initiation of DNA replication.

Poids moléculaire: 23 kDa (MW of target protein)

Pathways: DNA Replication, Synthesis of DNA